DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Chl1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_038964701.1 Gene:Chl1 / 89828 RGDID:620122 Length:1224 Species:Rattus norvegicus


Alignment Length:338 Identity:79/338 - (23%)
Similarity:127/338 - (37%) Gaps:59/338 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEF------TDVIENITVPAGRNVKLACSVKN 77
            |..:|:..:.|:.|.....|    ..|::....|:.      .....:.||..|..:.|.|..:.
  Rat   221 LTVNSLKHANDSSSSTEISN----QANSIKQRKPKLLLPPAQIGSASSKTVLKGDTLLLECFAEG 281

  Fly    78 LGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTV 142
            |.:.::.|            :.:.:..|:...|.:.|:|    .|.|.||..:|||.|.|..|.:
  Rat   282 LPTPQIEW------------SKLGSELPKGRATIEIHEK----TLKIENVSYQDRGNYRCTANNL 330

  Fly   143 TAKTQYGF-VKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTL 206
            ..|..:.| |.|..||.......|:  :...|.|..|.|:|:|.|:|||||:       |....:
  Rat   331 LGKASHDFHVIVEEPPRWKKKPQSA--VYSTGSNGILLCEAEGEPQPTIKWR-------VNGLPI 386

  Fly   207 EVHDLETD-----SLELERISRLHMGAYLCIASNGVPPSVSKRIKVS-VDFSPMVWIP----HQL 261
            |.|....|     .:....:...|...|.|.||| :..::.....:. ||..|::...    ::.
  Rat   387 ENHPFPGDVMFPREISFTNLQPNHTAVYQCEASN-IHGTILANANIDVVDVVPLIQTKNEENYET 450

  Fly   262 VGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSD 326
            |   :|::..|.|...|:|.:...|...::....|..:|       |.....|  |.|......|
  Rat   451 V---VGYSAFLHCEYFASPKATVVWEVADETHPLEGGRY-------HTHENGT--LEIERTTEED 503

  Fly   327 YGNYKCVAKNPRG 339
            .|:|.|...|..|
  Rat   504 AGSYSCWVDNTMG 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/96 (26%)
Ig 69..139 CDD:143165 17/69 (25%)
IG_like 165..249 CDD:214653 23/89 (26%)
IGc2 172..237 CDD:197706 22/69 (32%)
IG_like 267..348 CDD:214653 18/73 (25%)
Ig 270..339 CDD:299845 16/68 (24%)
Chl1XP_038964701.1 Ig 34..125 CDD:416386
Ig strand A 34..38 CDD:409353
Ig strand A' 43..47 CDD:409353
Ig strand B 52..59 CDD:409353
Ig strand C 65..70 CDD:409353
Ig strand C' 73..75 CDD:409353
Ig strand D 81..84 CDD:409353
Ig strand E 89..93 CDD:409353
Ig strand F 104..112 CDD:409353
Ig strand G 115..125 CDD:409353
IgI_2_L1-CAM_like 134..224 CDD:409432 1/2 (50%)
Ig strand B 148..152 CDD:409432
Ig strand C 162..166 CDD:409432
Ig strand E 185..189 CDD:409432
Ig strand F 200..205 CDD:409432
Ig strand G 216..219 CDD:409432
Ig 261..343 CDD:416386 24/97 (25%)
Ig strand B 273..277 CDD:409353 1/3 (33%)
Ig strand C 286..290 CDD:409353 1/15 (7%)
Ig strand E 308..312 CDD:409353 2/7 (29%)
Ig strand F 322..327 CDD:409353 2/4 (50%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig4_L1-NrCAM_like 347..434 CDD:409367 23/96 (24%)
Ig strand B 363..367 CDD:409367 1/3 (33%)
Ig strand C 376..380 CDD:409367 3/3 (100%)
Ig strand E 399..403 CDD:409367 0/3 (0%)
Ig strand F 413..418 CDD:409367 2/4 (50%)
Ig strand G 426..429 CDD:409367 0/2 (0%)
Ig 447..524 CDD:416386 19/82 (23%)
Ig strand A' 447..451 CDD:409353 0/3 (0%)
Ig strand B 454..463 CDD:409353 2/8 (25%)
Ig strand C 469..474 CDD:409353 1/4 (25%)
Ig strand C' 477..480 CDD:409353 0/2 (0%)
Ig strand D 485..490 CDD:409353 2/11 (18%)
Ig strand E 491..498 CDD:409353 3/8 (38%)
Ig strand F 505..513 CDD:409353 3/7 (43%)
Ig strand G 516..524 CDD:409353 1/1 (100%)
Ig 528..627 CDD:416386
Ig strand A 528..534 CDD:409353
Ig strand A' 537..542 CDD:409353
Ig strand B 545..553 CDD:409353
Ig strand C 564..568 CDD:409353
Ig strand D 583..586 CDD:409353
Ig strand E 589..593 CDD:409353
Ig strand F 602..609 CDD:409353
Ig strand G 616..620 CDD:409353
FN3 627..716 CDD:238020
fn3 730..811 CDD:394996
FN3 832..926 CDD:238020
FN3 931..1026 CDD:238020
Bravo_FIGEY 1120..1201 CDD:404722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.