DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and CLMP

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_079045.1 Gene:CLMP / 79827 HGNCID:24039 Length:373 Species:Homo sapiens


Alignment Length:371 Identity:76/371 - (20%)
Similarity:131/371 - (35%) Gaps:98/371 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWM----HFEQSAILTVH 97
            |.:|..|....::|        |.:|:|....:.|    ....:..:.|:    ...|..::|..
Human    15 GTLGTHTEIKRVAE--------EKVTLPCHHQLGL----PEKDTLDIEWLLTDNEGNQKVVITYS 67

  Fly    98 NHVITRNPRISVTHDKHDKHRTWF----------LHINNVQEEDRGRYMCQI-NTVTAKTQYGFV 151
            :..:..|    :|.::  |.|..|          |.|..::..|.|||.|:: |:......:..:
Human    68 SRHVYNN----LTEEQ--KGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVIL 126

  Fly   152 KVVVPPN-----IDDALTSSDIIVREGDNVTLRCKAKGSPEPTI-KWKRDDGNKIVINKTLEVHD 210
            ||:|.|:     ::..||       ||.::||:|::....||.: .|:|      :..|..|...
Human   127 KVLVRPSKPKCELEGELT-------EGSDLTLQCESSSGTEPIVYYWQR------IREKEGEDER 178

  Fly   211 LETDS---------LELERISRLHMGAYLCIASN--GVPPSVSKRIKVSVDFSPMV-WIPHQLVG 263
            |...|         :.|:.::..:.|.|.|.|.|  |....|   ::|:|.:...: .:...:.|
Human   179 LPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCV---VRVTVQYVQSIGMVAGAVTG 240

  Fly   264 IPIGFNITLECFIEANPTSLNYW--TRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSD 326
            |..|   .|..|       |..|  .|..|:     .:|:.|..|              |....|
Human   241 IVAG---ALLIF-------LLVWLLIRRKDK-----ERYEEEERP--------------NEIRED 276

  Fly   327 YGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAA 372
            ....|.....|.....|:......|..|.....:.:..:||.:|.|
Human   277 AEAPKARLVKPSSSSSGSRSSRSGSSSTRSTANSASRSQRTLSTDA 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 22/110 (20%)
Ig 69..139 CDD:143165 16/83 (19%)
IG_like 165..249 CDD:214653 22/95 (23%)
IGc2 172..237 CDD:197706 19/76 (25%)
IG_like 267..348 CDD:214653 15/82 (18%)
Ig 270..339 CDD:299845 13/70 (19%)
CLMPNP_079045.1 IgV_CAR_like 13..127 CDD:409552 24/129 (19%)
Ig strand B 31..35 CDD:409552 1/3 (33%)
Ig strand C 48..52 CDD:409552 0/3 (0%)
Ig strand E 94..98 CDD:409552 1/3 (33%)
Ig strand F 108..113 CDD:409552 3/4 (75%)
Ig strand G 121..124 CDD:409552 0/2 (0%)
IG 144..225 CDD:214652 23/96 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..373 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.