DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and BTN1A1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001723.2 Gene:BTN1A1 / 696 HGNCID:1135 Length:526 Species:Homo sapiens


Alignment Length:235 Identity:48/235 - (20%)
Similarity:88/235 - (37%) Gaps:36/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVI---ENITVPAGRNVKLACSVKNLGS---YKVAWMHFEQSAILTVH--------NHVITRNPR 106
            |||   |.|....|.:.:|.|.:....|   .::.|...:.|..:.||        ..:.....|
Human    30 DVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGR 94

  Fly   107 ISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSD---- 167
            .::..|...|.|. .|.|..|:..|.|.|.|..     :....:.:.:|  ::..|...||    
Human    95 ATLVQDGIAKGRV-ALRIRGVRVSDDGEYTCFF-----REDGSYEEALV--HLKVAALGSDPHIS 151

  Fly   168 IIVREGDNVTLRCKAKG-SPEPTIKWKRDDGNKIVINKTLEVHDLE-----TDSLELERISRLHM 226
            :.|:|...:.|.|.:.| .|||.::|:...|.|..........|.|     ..|:.:...|..::
Human   152 MQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNV 216

  Fly   227 GAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPI 266
            ..|:    ..:.....|::::|:..|.:..:...:|.:.:
Human   217 SCYI----QNLLLGQEKKVEISIPASSLPRLTPWIVAVAV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 21/106 (20%)
Ig 69..139 CDD:143165 18/80 (23%)
IG_like 165..249 CDD:214653 19/93 (20%)
IGc2 172..237 CDD:197706 15/70 (21%)
IG_like 267..348 CDD:214653 48/235 (20%)
Ig 270..339 CDD:299845
BTN1A1NP_001723.2 IG_like 35..141 CDD:214653 22/113 (19%)
Ig_MOG_like 43..142 CDD:143190 20/106 (19%)
Ig 162..223 CDD:299845 14/64 (22%)
SPRY_PRY_BTN1_2 302..473 CDD:293991
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.