DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and DIP-delta

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:407 Identity:167/407 - (41%)
Similarity:244/407 - (59%) Gaps:18/407 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRIS 108
            :.:|:.::|.|...|.|:||..||:..|.|.|::||.|||||:|.::..|||:|.|||:|.||.|
  Fly    36 VTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYS 100

  Fly   109 VTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNI-DDALTSSDIIVRE 172
            :|:..:    ||.||:|...::|||.||||:||....:|.|:::||||||| |...|.|.:.|||
  Fly   101 ITYTDN----TWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRE 161

  Fly   173 GDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGV 237
            ..|:.:.|:|.|.|.|.|.|:|:||.:|.:.|..:|...:.|.|.|.::||..||||||||:|||
  Fly   162 NQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGV 226

  Fly   238 PPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKT 302
            ||||||||.:.|:||||:|:|:||||.|.|.::|::|..||:|.::.||. .|..|:..|.||||
  Fly   227 PPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWV-YNSVMVLPSKKYKT 290

  Fly   303 ETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRT 367
            :....  ||:|.|:|||.|:|..|:|||:|::||..|:.:|:|::|       :.|..:|..::.
  Fly   291 DYTEN--SYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVY-------EIPLPSTPSKQV 346

  Fly   368 TTTAAEIALDGYINTPLNGNGIGI---VGEGPTNSVIASGKSSIKYLSNLNEIDKSKQKLTGSSP 429
            |.|..|...:..|.:..|.....:   ||....|.:.....||.....:.:....|....|.:.|
  Fly   347 THTTVESRENNIIPSSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSALP 411

  Fly   430 KGFDWSKGKSSGSHGNL 446
            .|...:...|.||.|:|
  Fly   412 GGVAGNSLSSMGSKGSL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 45/95 (47%)
Ig 69..139 CDD:143165 34/69 (49%)
IG_like 165..249 CDD:214653 42/83 (51%)
IGc2 172..237 CDD:197706 29/64 (45%)
IG_like 267..348 CDD:214653 34/80 (43%)
Ig 270..339 CDD:299845 30/68 (44%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 45/95 (47%)
Ig 145..238 CDD:416386 47/92 (51%)
Ig strand A 145..149 CDD:409353 3/3 (100%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 3/5 (60%)
Ig strand F 216..223 CDD:409353 6/6 (100%)
Ig strand G 230..238 CDD:409353 5/7 (71%)
Ig 242..333 CDD:416386 43/93 (46%)
Ig strand A' 250..253 CDD:409353 2/2 (100%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/5 (40%)
Ig strand C' 281..283 CDD:409353 1/1 (100%)
Ig strand D 289..293 CDD:409353 2/3 (67%)
Ig strand E 295..305 CDD:409353 5/11 (45%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10955
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29277
OrthoDB 1 1.010 - - D102261at50557
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
109.980

Return to query results.
Submit another query.