DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dscama

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio


Alignment Length:471 Identity:108/471 - (22%)
Similarity:148/471 - (31%) Gaps:136/471 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSVALSTDTGSEGNAG-----NVGGSTLNNVISEDPEFTDV--IENITVPAGRNVKLACSVKNLG 79
            |.|...|...|.|...     ||.||            .|:  ::|:|..||.::.:.|.|....
Zfish   480 SGVYRCTCNNSAGTVSYQARINVRGS------------ADIRPMKNLTAIAGWDMYIHCHVIGYP 532

  Fly    80 SYKVAWMH-------------FEQSAILTVHN--------------------------HVITRNP 105
            .|.:.|..             ||.:..|.:.|                          ||..:.|
Zfish   533 YYSIKWFKNSNLLPFNDRQRAFENNGTLKLLNVQKELDEGEYSCHVQVQPQLFKNQSVHVTVKVP 597

  Fly   106 ----------------------------RISVTHDKHDK-------------HRTWFLHINNVQE 129
                                        .||:|.:|..|             ..|..|.|:|:|.
Zfish   598 PFIQPFEFPRYSIGHRVFVPCVVRSGDLPISITWEKDGKSINASLGVTIDNIDFTSSLRISNLQR 662

  Fly   130 EDRGRYMCQINTVTAKTQYGFVKVV-VPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWK 193
            ...|.|.|......|..:|....:| |||.........|.|.  |.:|.|.|.|.|.|.|||:||
Zfish   663 VHNGTYTCIAQNDAAVVKYQSQLIVRVPPRFKVQPQDQDGIY--GKSVILNCSADGEPRPTIEWK 725

  Fly   194 RDDG------NKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFS 252
            ...|      ..|.:|....|..|...||.::.:.....|.|||..||.|...|||.:.::|.  
Zfish   726 YSKGAGVPQFQPIALNSGFRVQLLGNGSLLIKHVLEEDAGYYLCKVSNDVGADVSKSMYLNVK-- 788

  Fly   253 PMVWIPHQLVGIP------IGFNITLECFIEANPTSLNYWTRE-----NDQMITESSKYKTETIP 306
                ||..:...|      .|..|.:.|........:..|.:|     ...||.......|.|:.
Zfish   789 ----IPAMITSYPNNSLATKGEKIEMSCKAHGEKPIMVRWEKEVEKEKQSHMINPDMWRHTVTVK 849

  Fly   307 GHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPT--------TTT 363
             :...:....|.|......|.|.:.|.|.|..|:..|.::|.:..||  :||..        |..
Zfish   850 -NVGDEVVSTLQIYPTMREDSGFFSCHAINSYGEDRGILQLTVQEPP--EPPKVEIREVKERTIA 911

  Fly   364 LRRTTTTAAEIALDGY 379
            ||.|........:.||
Zfish   912 LRWTMGFDGNSLITGY 927

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 31/176 (18%)
Ig 69..139 CDD:143165 24/149 (16%)
IG_like 165..249 CDD:214653 31/89 (35%)
IGc2 172..237 CDD:197706 25/70 (36%)
IG_like 267..348 CDD:214653 18/85 (21%)
Ig 270..339 CDD:299845 15/73 (21%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352
IG_like 321..402 CDD:214653
I-set 408..502 CDD:333254 5/21 (24%)
IGc2 524..579 CDD:197706 8/54 (15%)
Ig 614..679 CDD:319273 14/64 (22%)
Ig_DSCAM 708..787 CDD:143211 28/78 (36%)
Ig 805..898 CDD:325142 21/95 (22%)
FN3 894..988 CDD:238020 10/36 (28%)
FN3 995..1092 CDD:238020
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.