DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and aebp1b

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:372 Identity:76/372 - (20%)
Similarity:123/372 - (33%) Gaps:109/372 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTS 165
            :|.:.:..::|...::|           .|||        .||:......|| ::||.       
Zfish    27 LTEHSKSEISHTDREQH-----------VEDR--------NVTSVEDLLQVK-IIPPY------- 64

  Fly   166 SDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVI-NKTLEVHDLET--DSLELERISRLHMG 227
              ..:..|.:..|.||. .|....|.|...:|.|::. :..|:||:..:  .||.:...:..:.|
Zfish    65 --ATIEVGQHKQLLCKV-SSDAKNINWVSPNGEKVLTKHGNLKVHNHGSVLSSLTVLNANLNNAG 126

  Fly   228 AYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQ 292
            .|.|:|:||   ....:..|.:|.                              .|....|:.|:
Zfish   127 IYKCVATNG---DTESQATVKLDI------------------------------ILKRMRRDTDR 158

  Fly   293 MITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQP 357
            ...|....:.:......:.|.|.:.........:.|..|...||  .:....:.....:|.||.|
Zfish   159 KGREKRLKEPKPSKKPKASKPTKKPKSEKKGKGEKGGKKKGKKN--REESTTVATTTVAPTTTVP 221

  Fly   358 -------------------PPTTTTLRRTTTTAAEIA------LDGYINTPLNGNGIGIVGE-GP 396
                               |..|||:.|||||..|..      :|.| :.|.:.:....|.| .|
Zfish   222 MEYEEFYDPEPDQYWDEDFPAETTTVARTTTTPTEKTKDFIPDMDEY-SQPDSYDDYWKVDEPTP 285

  Fly   397 TNSVIASGKS---------SIKYLSNLNEIDKSKQKLTGSSPKGFDW 434
            |.||||...:         |::.:.||...|..:...|.:     ||
Zfish   286 TTSVIAGRPADDDDYWDARSVEMVENLPFPDGKEISSTDN-----DW 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 10/53 (19%)
Ig 69..139 CDD:143165 6/37 (16%)
IG_like 165..249 CDD:214653 21/86 (24%)
IGc2 172..237 CDD:197706 19/67 (28%)
IG_like 267..348 CDD:214653 10/80 (13%)
Ig 270..339 CDD:299845 10/68 (15%)
aebp1bXP_696022.6 Ig 56..147 CDD:299845 25/104 (24%)
IG_like 62..145 CDD:214653 23/95 (24%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.