DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and pigr

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001289179.1 Gene:pigr / 566471 ZFINID:ZDB-GENE-060503-327 Length:335 Species:Danio rerio


Alignment Length:253 Identity:52/253 - (20%)
Similarity:95/253 - (37%) Gaps:53/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIE--NITVPAG------RNVKLACSV 75
            |:.:::.|....||......:|.             ..|:|  ::|||..      .|||..||.
Zfish     5 LLLTALVLGGLPGSHSTVTTIGD-------------VAVLEGGSVTVPCHYNPQYISNVKYWCSG 56

  Fly    76 KNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQIN 140
            :         |....|::....:.....|....||.........:.:::.|:.|:|.|.|.|.:.
Zfish    57 R---------MREFCSSLARTDDPESAPNGNRKVTIADDPTQHVFTVNMRNLTEDDSGWYWCGVE 112

  Fly   141 T----VTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRC-KAKGSPEPTIKWKRD----- 195
            .    |:..|...::.||...::.:.:.|::    ||.:|:::| .:|.......:|.|.     
Zfish   113 LGGMWVSDSTASLYISVVQGMSVVNGMVSAE----EGKSVSVQCLYSKNLRSSEKRWCRSGNWNS 173

  Fly   196 ----DGNKIVINKTLEVHDLETD--SLELERISRLHMGAYLCIASN---GVPPSVSKR 244
                |.......|.:.:||.:..  ::.|:|:.....|.|.|.|..   .|..||::|
Zfish   174 CLLTDSEGTFSGKNVHIHDDKNSVFTVTLQRLEMRDSGWYWCGAGQQNVAVHVSVTRR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 23/107 (21%)
Ig 69..139 CDD:143165 15/69 (22%)
IG_like 165..249 CDD:214653 22/95 (23%)
IGc2 172..237 CDD:197706 17/79 (22%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
pigrNP_001289179.1 IG_like 26..127 CDD:214653 24/122 (20%)
Ig_pIgR 28..115 CDD:143193 21/95 (22%)
Ig_pIgR 139..231 CDD:143193 21/95 (22%)
IG_like 140..228 CDD:214653 19/91 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.