DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and paplna

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_005169942.1 Gene:paplna / 562930 ZFINID:ZDB-GENE-070815-4 Length:1187 Species:Danio rerio


Alignment Length:240 Identity:56/240 - (23%)
Similarity:95/240 - (39%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NVGGSTLNNV-ISE---------------DPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWM 86
            :|.||:.||. |||               :.:::.::|   ..||:..||.|||..:.:.....:
Zfish   919 SVSGSSQNNAGISEVDSSQSYTSQSSSRFNIDYSPLVE---ARAGQTAKLQCSVLPVSAIHAVTI 980

  Fly    87 HFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFV 151
            |:.::.           .|..|:   :|.:|....|.|..:..:|.|.|.|   |||...::...
Zfish   981 HWSRAG-----------QPLNSL---RHSQHSDGTLVIKQLTADDSGLYTC---TVTDAQKFEER 1028

  Fly   152 KVVVPPNIDDALTSS--DIIVREGDNVTLRCKAKGSPEPTIKWKRD------DGNKIVINKTLEV 208
            :|.:....|..:|.:  |:.|.:|....|.|...|. ...:.|.|:      ||::        |
Zfish  1029 QVQLRVLGDLRITKAPIDVDVVQGSTAQLACVVTGE-NVNVGWSRNGVPVRPDGHR--------V 1084

  Fly   209 HDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSP 253
            |.....:|.|..:..:..|.|.|.|..|. .|||...::.:..:|
Zfish  1085 HVSADGTLILNNVQSVDEGTYTCNAYTGT-LSVSAAAEIRLAKTP 1128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 23/95 (24%)
Ig 69..139 CDD:143165 16/69 (23%)
IG_like 165..249 CDD:214653 22/91 (24%)
IGc2 172..237 CDD:197706 16/70 (23%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
paplnaXP_005169942.1 TSP1 24..75 CDD:214559
ADAM_spacer1 181..293 CDD:310520
TSP1 303..356 CDD:214559
TSP1 388..442 CDD:214559
TSP1 449..498 CDD:214559
TSP1 504..557 CDD:214559
KU 720..771 CDD:238057
Ig_3 839..906 CDD:316449
IGc2 960..1022 CDD:197706 20/78 (26%)
I-set 1039..1121 CDD:333254 23/91 (25%)
PLAC 1142..1173 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.