Sequence 1: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021335124.1 | Gene: | igsf5a / 561211 | ZFINID: | ZDB-GENE-091204-182 | Length: | 331 | Species: | Danio rerio |
Alignment Length: | 223 | Identity: | 46/223 - (20%) |
---|---|---|---|
Similarity: | 74/223 - (33%) | Gaps: | 48/223 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 ENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLH 123
Fly 124 INNVQEEDRGRYMCQI---NTVTAKTQY---GFVKVVVPPNIDDALTSSDIIVREGDNVT----- 177
Fly 178 ---LRCKAKG-SPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIA----- 233
Fly 234 ----SNGVPPSVSKR-----IKVSVDFS 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | 22/101 (22%) |
Ig | 69..139 | CDD:143165 | 13/69 (19%) | ||
IG_like | 165..249 | CDD:214653 | 21/106 (20%) | ||
IGc2 | 172..237 | CDD:197706 | 17/82 (21%) | ||
IG_like | 267..348 | CDD:214653 | |||
Ig | 270..339 | CDD:299845 | |||
igsf5a | XP_021335124.1 | I-set | 21..115 | CDD:333254 | 20/91 (22%) |
Ig | <138..201 | CDD:325142 | 12/63 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |