DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and igsf5a

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_021335124.1 Gene:igsf5a / 561211 ZFINID:ZDB-GENE-091204-182 Length:331 Species:Danio rerio


Alignment Length:223 Identity:46/223 - (20%)
Similarity:74/223 - (33%) Gaps:48/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLH 123
            :|..|..|.:.:..||...........::......:...:.|:....|.|.::.....:..|...
Zfish    23 QNAAVLQGSSAQFNCSSTQPPQIMTFMLNGRLVVTIMQTSGVLNSTDRFSASNFTTPGNYKWQFT 87

  Fly   124 INNVQEEDRGRYMCQI---NTVTAKTQY---GFVKVVVPPNIDDALTSSDIIVREGDNVT----- 177
            |:|||..|.|...||:   :.|||....   |.|::.                  |.|.|     
Zfish    88 ISNVQRSDAGVVACQVLGGDAVTATLSVQDRGTVQIA------------------GGNQTKMLGV 134

  Fly   178 ---LRCKAKG-SPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIA----- 233
               ..|.|.| .|||.:.|..:...:.....::....|...|..| .::........|:|     
Zfish   135 QTQFSCLAAGWYPEPNMSWSVNGETQFCNKSSVTQGGLYNSSCTL-TLTASKNSTVQCLAAIPAL 198

  Fly   234 ----SNGVPPSVSKR-----IKVSVDFS 252
                ||.|..:|.|:     |.::|.||
Zfish   199 NTPDSNTVFLTVVKKDQTVLIAITVAFS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 22/101 (22%)
Ig 69..139 CDD:143165 13/69 (19%)
IG_like 165..249 CDD:214653 21/106 (20%)
IGc2 172..237 CDD:197706 17/82 (21%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
igsf5aXP_021335124.1 I-set 21..115 CDD:333254 20/91 (22%)
Ig <138..201 CDD:325142 12/63 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.