DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and robo4

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:256 Identity:63/256 - (24%)
Similarity:99/256 - (38%) Gaps:75/256 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 HDKHRTWFLHINNVQEEDR------GRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVRE 172
            |.:||  .:| ......||      .|.:.:||         ..::|..|        ||::||.
Zfish    40 HLRHR--LMH-QRASHRDRAHRRKGSRLVSEIN---------LPRIVHHP--------SDVVVRV 84

  Fly   173 GDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELE------------------ 219
            |...||.|:|:|:|||||:|.|:.            ..|:||.::.:                  
Zfish    85 GSPATLSCRAEGNPEPTIQWLRNG------------QPLDTDKMDAQSQPIVLPDGSLFFFSVVP 137

  Fly   220 -RISRLHMGAYLCIASNGVPPSVSKRIKVSV-----DFSPMVWIPHQLVGIPIGFNITLECFIEA 278
             |..:.|...|.|||.|.:..:.|:...:.:     ||.    :....|.:.||...|:.|....
Zfish   138 GRKGQSHEAVYACIAHNSIGNATSRNASLHIAALREDFR----VQPSDVEVAIGEMATINCSPPV 198

  Fly   279 NPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRG 339
            .....|...|::..:|..|:::.|| :.|        :|.|...|.:|.|.|.|:|.|..|
Zfish   199 GHPEPNVTWRKDGILINSSNEHYTE-LKG--------KLIIAPAQKNDSGVYSCIASNMIG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 9/46 (20%)
Ig 69..139 CDD:143165 7/30 (23%)
IG_like 165..249 CDD:214653 28/102 (27%)
IGc2 172..237 CDD:197706 23/83 (28%)
IG_like 267..348 CDD:214653 20/73 (27%)
Ig 270..339 CDD:299845 18/68 (26%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 30/118 (25%)
I-set 71..168 CDD:254352 30/116 (26%)
I-set 175..261 CDD:254352 23/89 (26%)
Ig2_Robo 177..261 CDD:143201 22/83 (27%)
I-set 265..350 CDD:254352
Ig 282..350 CDD:299845
FN3 373..448 CDD:214495
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.