DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and si:dkey-182g1.4

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_005161711.1 Gene:si:dkey-182g1.4 / 560083 ZFINID:ZDB-GENE-060503-808 Length:370 Species:Danio rerio


Alignment Length:325 Identity:60/325 - (18%)
Similarity:111/325 - (34%) Gaps:100/325 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EFTDVIENITVPAGRNVKLACSVKNLGSY-KVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDK 116
            :.|:.::.|:|..|..:.|...|..:..| .:.|| ||.:.|..|:     |..:|:.|:|..::
Zfish    24 DMTEEVKIISVREGDPLALHTDVDEVSRYLLIQWM-FENTRIAEVN-----RLSKINSTYDGPEE 82

  Fly   117 --------HRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREG 173
                    .:|..|.|.|.:..|.|.|...|..:...:...|                       
Zfish    83 TFRGRLKLDQTGSLTITNTRSTDSGLYKLSIYKLQQISYIHF----------------------- 124

  Fly   174 DNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDL-----ETDSLELERISRLHMGAYLCIA 233
             .||:             :.|..|:..|.:|..:.:.:     |||..:|               
Zfish   125 -QVTI-------------YGRSSGSDCVSSKCTKSNSVTNQPDETDITKL--------------- 160

  Fly   234 SNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFI-EANPTSLNYWTRENDQM--IT 295
                |.|.|..:|.              :.:..|.::||...: :.....|..|..||.::  :.
Zfish   161 ----PQSTSAEVKT--------------ISVMEGDSVTLHTGVTDVQKYLLIQWMLENTRIAEVN 207

  Fly   296 ESSKYKTETIPGHPSYKATMR------LTITNVQSSDYGNYKCVAKNPRG-DMDGNIKLYMSSPP 353
            ..::.:......|..::..::      |.|.|..::|.|.||........ .::.|:.:|:||.|
Zfish   208 RLAQNRAAYDGPHGRFRDRLKLDETGSLIIINTTTTDSGLYKLTLVIQESIYVNFNLTVYVSSSP 272

  Fly   354  353
            Zfish   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/104 (24%)
Ig 69..139 CDD:143165 20/78 (26%)
IG_like 165..249 CDD:214653 14/88 (16%)
IGc2 172..237 CDD:197706 10/69 (14%)
IG_like 267..348 CDD:214653 16/90 (18%)
Ig 270..339 CDD:299845 14/77 (18%)
si:dkey-182g1.4XP_005161711.1 Ig 55..126 CDD:299845 19/100 (19%)
Ig 176..268 CDD:299845 16/91 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.