DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and kirrel3l

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001092814.2 Gene:kirrel3l / 557315 ZFINID:ZDB-GENE-070831-1 Length:755 Species:Danio rerio


Alignment Length:335 Identity:71/335 - (21%)
Similarity:107/335 - (31%) Gaps:103/335 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QEEDRGR-YMCQI----------NTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCK 181
            ::.|.|| |.|::          .:||...|:       ||::  .|:.....|.||..|...|.
Zfish   187 EDSDSGRTYTCRVLNPAAPAGRQTSVTINVQH-------PPSV--TLSVQPQTVMEGAKVLFICS 242

  Fly   182 AKGSPEPT-IKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRI 245
            |..:||.| .:|.:..         :.:.:...||||:............|..||.| .|.:...
Zfish   243 ASANPEITGYRWSKGG---------VPISEANGDSLEVTADHSYFTDPVSCEVSNSV-GSTNVST 297

  Fly   246 KVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPS 310
            .|.|.|.|.:....:...:.||.:....|....||.....||::...::..:|.           
Zfish   298 LVDVQFGPRLLTEPKPQIVDIGMDAAFTCSWTGNPPLTLAWTKQGSNVVLSNSN----------- 351

  Fly   311 YKATMRLTITNVQSSDYGNYKCVAKNPR-GDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEI 374
                 .|.:..|...|.|.|.|.|..|| |..:.::.|.::.||                     
Zfish   352 -----TLQLKAVTQDDTGTYTCKAIVPRIGVAERDVTLTVNGPP--------------------- 390

  Fly   375 ALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEIDKSKQKLTGSS--PKGFDWSKG 437
                            |:....|...|...|..:             :.|.|||  |....|:.|
Zfish   391 ----------------IITAEATQQAIKHSKGKL-------------ECLVGSSPPPDKIVWTFG 426

  Fly   438 K---SSGSHG 444
            .   ||||.|
Zfish   427 DMMLSSGSSG 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 8/37 (22%)
Ig 69..139 CDD:143165 5/11 (45%)
IG_like 165..249 CDD:214653 20/84 (24%)
IGc2 172..237 CDD:197706 16/65 (25%)
IG_like 267..348 CDD:214653 17/81 (21%)
Ig 270..339 CDD:299845 15/69 (22%)
kirrel3lNP_001092814.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.