DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and cby1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_012816531.2 Gene:cby1 / 549007 XenbaseID:XB-GENE-856225 Length:164 Species:Xenopus tropicalis


Alignment Length:107 Identity:25/107 - (23%)
Similarity:34/107 - (31%) Gaps:46/107 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 VPPSVS-------------KRIKVSVDF-SPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWT 287
            |||..|             |.:::.:|: ||.:.|..|                     ||.:  
 Frog    52 VPPRKSASLSNLHALDRTTKEVELGLDYGSPSINIAGQ---------------------SLKF-- 93

  Fly   288 RENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGN 329
             ||...||||.        |..|.:...||...|.|..:..|
 Frog    94 -ENGHWITESG--------GTGSQREVQRLRKRNQQLEEENN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653
Ig 69..139 CDD:143165
IG_like 165..249 CDD:214653 5/24 (21%)
IGc2 172..237 CDD:197706 25/107 (23%)
IG_like 267..348 CDD:214653 15/63 (24%)
Ig 270..339 CDD:299845 15/60 (25%)
cby1XP_012816531.2 Chibby 40..151 CDD:405348 25/107 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.