DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Cntn3

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_062202.1 Gene:Cntn3 / 54279 RGDID:3253 Length:1028 Species:Rattus norvegicus


Alignment Length:524 Identity:116/524 - (22%)
Similarity:196/524 - (37%) Gaps:151/524 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CLIASSVALSTDTGSEGNAGNVGGSTLNNVISED---PEFTDVIE---NITVPA--GRNVKLACS 74
            |::.|:|.         || .|.||....|:..|   .|:...||   ..|:||  |..|||.|.
  Rat   196 CVVTSTVT---------NA-RVLGSPTPLVLRSDGVMGEYEPKIELQFPETLPAAKGSTVKLECF 250

  Fly    75 VKNLGSYKVAW-----MHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGR 134
            .......::.|     |.|.....|...|.|                     |.|.|.|:||.|.
  Rat   251 ALGNPVPQINWRRSDGMPFPTKIKLRKFNGV---------------------LEIPNFQQEDTGS 294

  Fly   135 YMCQINTVTAK-------TQYG---FVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPT 189
            |.|.......|       |.|.   :|:::           .|:.....|::...|:|.|.|:|:
  Rat   295 YECIAENSRGKNVARGRLTYYAKPYWVQLL-----------KDVETAVEDSLYWECRASGKPKPS 348

  Fly   190 IKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASN--GVPPSVSKRIKV---SV 249
            .:|.: :|:.:|:.:.:::   |..:|.:..::....|.:.|||.|  |:..| |..:||   :.
  Rat   349 YRWLK-NGDALVLEERIQI---ENGALTIANLNVSDSGMFQCIAENKHGLIYS-SAELKVLASAP 408

  Fly   250 DFS--PMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYK 312
            |||  ||    .:::.:.:|..:.|:|...|:|.:|::| ::.|.::.|.::.......|     
  Rat   409 DFSRNPM----KKMIQVQVGSLVILDCKPSASPRALSFW-KKGDTVVREQARISLLNDGG----- 463

  Fly   313 ATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAA----- 372
                |.|.||..:|.|.|.|:|:|..|..:|..:|.::.       ||...|..:....|     
  Rat   464 ----LKIMNVTKADAGIYTCIAENQFGKANGTTQLVVTE-------PTRIILAPSNMDVAVGESI 517

  Fly   373 ------------EIALDGYINTPL-----NGNGIGIVGEGPTNSVIASG---KSSIKYL----SN 413
                        :|....|.|..|     :|:....||...:..::...   |.|.||:    :.
  Rat   518 ILPCQVQHDPLLDIMFAWYFNGTLTDFKKDGSHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTG 582

  Fly   414 LNEIDKSKQKLTGSSP---------------KGFDWSKGKSSGSHGNLMASSWPLICCILALLTT 463
            ::.:..:.:.:...||               ....|::|..|.|         |:|...:...|.
  Rat   583 VDSVSSAAELIVRGSPGPPENVKVDEITDTTAQLSWTEGTDSHS---------PVISYAVQARTP 638

  Fly   464 HSCG 467
            .|.|
  Rat   639 FSVG 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 28/115 (24%)
Ig 69..139 CDD:143165 19/74 (26%)
IG_like 165..249 CDD:214653 22/88 (25%)
IGc2 172..237 CDD:197706 16/66 (24%)
IG_like 267..348 CDD:214653 22/80 (28%)
Ig 270..339 CDD:299845 19/68 (28%)
Cntn3NP_062202.1 Ig 25..114 CDD:299845
I-set 26..117 CDD:254352
Ig 120..214 CDD:299845 8/27 (30%)
IG_like 130..205 CDD:214653 3/17 (18%)
Ig 227..315 CDD:299845 27/108 (25%)
IG_like 234..313 CDD:214653 24/99 (24%)
I-set 318..403 CDD:254352 21/100 (21%)
Ig 320..403 CDD:299845 21/98 (21%)
I-set 408..496 CDD:254352 28/101 (28%)
Ig 424..496 CDD:299845 23/81 (28%)
IG_like 506..594 CDD:214653 12/87 (14%)
Ig 515..598 CDD:299845 11/82 (13%)
FN3 598..695 CDD:238020 10/54 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..714
FN3 703..795 CDD:238020
FN3 805..898 CDD:238020
FN3 906..991 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.