| Sequence 1: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
| Alignment Length: | 225 | Identity: | 65/225 - (28%) |
|---|---|---|---|
| Similarity: | 96/225 - (42%) | Gaps: | 31/225 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 40 GGSTLNNVI--SEDPEFTD---VIENITVPAGRNVKLACSVKNLGSY-----KVAWMHFEQSAIL 94
Fly 95 TVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFV--KVVVPP 157
Fly 158 NIDDALTSSDIIVREGDNVTLRCKAKGSPEPT--IKWKRDDGNKIVINKTLEVHDLETDSLELER 220
Fly 221 I-SRL--------HMGAYLCIASNGVPPSV 241 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | 28/102 (27%) |
| Ig | 69..139 | CDD:143165 | 18/74 (24%) | ||
| IG_like | 165..249 | CDD:214653 | 25/88 (28%) | ||
| IGc2 | 172..237 | CDD:197706 | 21/75 (28%) | ||
| IG_like | 267..348 | CDD:214653 | |||
| Ig | 270..339 | CDD:299845 | |||
| dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 27/99 (27%) |
| Ig_3 | 193..271 | CDD:404760 | 21/80 (26%) | ||
| Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 250..254 | CDD:409353 | 3/3 (100%) | ||
| Ig strand F | 264..269 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||