DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and tutl

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:531 Identity:118/531 - (22%)
Similarity:190/531 - (35%) Gaps:174/531 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AYHLEAISSFLYVGLGCLIASSVALSTD---------------TGS----------------EGN 35
            |.|:.||     :|.|.:....|....|               |||                ||.
  Fly   135 AVHITAI-----LGEGVIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGY 194

  Fly    36 AGNV---------GGSTLN--NVISED-------------------------------PEFTDVI 58
            .|.|         |.::||  |:...|                               |.|:...
  Fly   195 KGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTP 259

  Fly    59 ENIT-VPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFL 122
            |:|. |..|.::.|.|......:.::.|  ::.:       :.:..:|.:.:.:|..:      |
  Fly   260 EDIIYVNLGDSIILNCQADGTPTPEILW--YKDA-------NPVDPSPTVGIFNDGTE------L 309

  Fly   123 HINNVQEEDRGRYMC-------QINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRC 180
            .|:.::.||.|.|.|       |::........|...::|||.....|        ||:.|...|
  Fly   310 RISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPTNQTKL--------EGEKVIFSC 366

  Fly   181 KAKGSP-EPTIKWKRDDGNKIVINKTLEVHDLET-------DSLELERISRLHMGAYLCIASNGV 237
            :||..| ..|::|.| :|:.:     .||..|||       .||.:..|.....|.|||..:||:
  Fly   367 EAKAMPGNVTVRWYR-EGSPV-----REVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGI 425

  Fly   238 --PPSVSKRIKV----SVDFSPMV-WIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMIT 295
              |.|.|..:.|    .|.|:|.| ::|.:|.|:       ::|:|:::| .|.|.|...|:.:.
  Fly   426 GDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGV-------VQCYIKSSP-QLQYVTWTKDKRLL 482

  Fly   296 ESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRG--DMDGNIKLYMSSPP--TTQ 356
            |..:.|...:..:.|      |..|.|.....|.|.|...|.:|  ...|.:.:.:..||  |.:
  Fly   483 EPYQMKDIVVMANGS------LLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVE 541

  Fly   357 PPPTTTTLRRTTTTAAEIALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYL----SNLNEI 417
            |   .|..:|....:.|:..|.     |...|.    |.||          ||:.    ..|.|.
  Fly   542 P---ETLYQRKVGDSVEMHCDA-----LEAEGT----ERPT----------IKWQRQEGEQLTES 584

  Fly   418 DKSKQKLTGSS 428
            .:::.|::|.:
  Fly   585 QRNRIKISGGN 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 18/103 (17%)
Ig 69..139 CDD:143165 12/76 (16%)
IG_like 165..249 CDD:214653 29/97 (30%)
IGc2 172..237 CDD:197706 24/72 (33%)
IG_like 267..348 CDD:214653 19/82 (23%)
Ig 270..339 CDD:299845 17/68 (25%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 19/117 (16%)
IG_like 137..229 CDD:214653 19/96 (20%)
I-set 253..341 CDD:254352 19/102 (19%)
IGc2 268..331 CDD:197706 13/77 (17%)
I-set 346..437 CDD:254352 32/104 (31%)
Ig 349..437 CDD:299845 32/101 (32%)
Ig 459..530 CDD:299845 19/84 (23%)
IG_like 549..628 CDD:214653 13/66 (20%)
IGc2 551..617 CDD:197706 13/64 (20%)
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.