DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and cadm2

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_031751706.1 Gene:cadm2 / 448238 XenbaseID:XB-GENE-998536 Length:441 Species:Xenopus tropicalis


Alignment Length:411 Identity:102/411 - (24%)
Similarity:169/411 - (41%) Gaps:92/411 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VIENITVPAGRNVKLACSVKNLGSYKVAW-------MHFEQSAILTVHNHVITRNPRISVTHDKH 114
            |.:|:||..|..:.|.|.|....:..:.|       ::|:....|        |:.||.:.    
 Frog    36 VTQNVTVVEGGTINLTCRVDQNDNTSLQWSNPAQQTLYFDDKKAL--------RDNRIELV---- 88

  Fly   115 DKHRTWF---LHINNVQEEDRGRYMCQINTVTAKTQYGFVKVV-VP--PNIDDALTSSDIIVREG 173
              ..:|.   :.|::|...|.|:|.|.:.|:..||...::.|: ||  |:| ...||.   |.||
 Frog    89 --RASWHELSISISDVSLSDEGQYTCSLFTMPVKTSKAYLMVLGVPENPHI-SGFTSP---VMEG 147

  Fly   174 DNVTLRCKAKGS-PEPTIKWKRDDGNKIVINKTLEVHDLE------TDSLELERISRLHMGAYL- 230
            |.:.|.||:.|| |...|:|.::| .:|...:.::..|..      |.||..:. .|...||.: 
 Frog   148 DTIQLTCKSSGSKPAADIRWFKND-QEITDVQKIQQQDSNGKTFTVTSSLVFQG-DRKDDGAVIR 210

  Fly   231 C------IASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPI---GFNITLECFIEANP-TSLNY 285
            |      :.|.   |.::|:: :.:.::|.|.|   |...|:   |..:.|.|..:..| .....
 Frog   211 CRVDHESLTST---PQIAKQV-LEIHYTPTVRI---LPSTPLPQEGQPLILICESKGKPLPEPVL 268

  Fly   286 WTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMS 350
            ||::..::    ...:..|:.|.       .|||:.:..:|.|.|:|.|.|..|.......|.::
 Frog   269 WTKDGGEL----PDPERMTVNGR-------ELTISFLNKTDNGTYRCEATNSIGQSSAEYVLIIN 322

  Fly   351 S------PPTTQPPPTTTTLRRT------TTTAAEI-----ALDGYINT--PLNGNGIGIVGEGP 396
            .      |.|..|..|:.|::..      ||.:|.|     ||.|.:.|  .|.|..:.:|....
 Frog   323 DVPKPLFPTTIIPLFTSATVKTNVAMSTRTTKSAFITKDPNALPGPVATDHALIGGVVAVVVFVT 387

  Fly   397 TNSVIASGKSSIK----YLSN 413
            ..|:|..|:...:    ||:|
 Frog   388 LCSIILIGRYLARHKGTYLTN 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 24/106 (23%)
Ig 69..139 CDD:143165 16/79 (20%)
IG_like 165..249 CDD:214653 26/97 (27%)
IGc2 172..237 CDD:197706 22/78 (28%)
IG_like 267..348 CDD:214653 18/81 (22%)
Ig 270..339 CDD:299845 16/69 (23%)
cadm2XP_031751706.1 IgV_1_Necl-3 34..129 CDD:409498 24/106 (23%)
Ig strand B 48..52 CDD:409498 1/3 (33%)
Ig strand C 61..65 CDD:409498 0/3 (0%)
Ig strand E 95..99 CDD:409498 0/3 (0%)
Ig strand F 109..114 CDD:409498 2/4 (50%)
Ig strand G 121..124 CDD:409498 1/2 (50%)
IgI_2_Necl-3 128..231 CDD:409467 32/112 (29%)
Ig strand B 150..154 CDD:409467 1/3 (33%)
Ig strand C 164..168 CDD:409467 1/3 (33%)
Ig strand E 194..198 CDD:409467 2/3 (67%)
Ig strand F 208..213 CDD:409467 1/4 (25%)
Ig strand G 224..227 CDD:409467 0/2 (0%)
IGc2 248..311 CDD:197706 17/73 (23%)
Ig strand B 250..259 CDD:409353 2/8 (25%)
Ig strand C 265..271 CDD:409353 1/5 (20%)
Ig strand C' 274..277 CDD:409353 0/6 (0%)
Ig strand D 280..285 CDD:409353 1/4 (25%)
Ig strand E 286..293 CDD:409353 4/13 (31%)
Ig strand F 300..308 CDD:409353 4/7 (57%)
Ig strand G 311..321 CDD:409353 2/9 (22%)
4.1m 394..412 CDD:128590 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.