DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and robo2

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster


Alignment Length:430 Identity:102/430 - (23%)
Similarity:150/430 - (34%) Gaps:121/430 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSTDTGS--------------------EGNAG-------NVGG------STLNNVISEDPEFTDV 57
            |.|||||                    |.:||       |..|      :||......| ||...
  Fly   131 LKTDTGSHRIMLPAGGLFFLKVIHSRRESDAGTYWCEAKNEFGVARSRNATLQVAFLRD-EFRLE 194

  Fly    58 IENITVPAGRNVKLACSVKNLGS--YKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTW 120
            ..|..|..|....:.|.... ||  .:::|....|:..|       ..|.||.:....:      
  Fly   195 PANTRVAQGEVALMECGAPR-GSPEPQISWRKNGQTLNL-------VGNKRIRIVDGGN------ 245

  Fly   121 FLHINNVQEEDRGRYMCQINTV--TAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAK 183
             |.|...::.|.|||.|.:..|  |.::...|:||.|.|.:.....:...:|  |.:|..:|:..
  Fly   246 -LAIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVRPFLIRGPQNQTAVV--GSSVVFQCRIG 307

  Fly   184 GSPEPTIKWKRD-DGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGV---------- 237
            |.|.|.:.|:|. .|..:.:.:   ||.||..||:|:.::...||.|.|.|.|.|          
  Fly   308 GDPLPDVLWRRTASGGNMPLRR---VHVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATGILT 369

  Fly   238 ---PPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSK 299
               ||....|.|            :|||  .||..:..||....:|....||:.|.:..:     
  Fly   370 VHAPPKFVIRPK------------NQLV--EIGDEVLFECQANGHPRPTLYWSVEGNSSL----- 415

  Fly   300 YKTETIPGHPSYKATMRLT--------ITNVQSSDYGN-YKCVAKNPRGDMDGNIKLYMSS---- 351
                .:||:...:..:.||        |......|.|. ..|.|.|..|.:.....:.:.:    
  Fly   416 ----LLPGYRDGRMEVTLTPEGRSVLSIARFAREDSGKVVTCNALNAVGSVSSRTVVSVDTQFEL 476

  Fly   352 -PPTTQPPPTTTTL----------RRTTTTAAEIA--LDG 378
             ||..:..|...||          |...|...:::  |||
  Fly   477 PPPIIEQGPVNQTLPVKSIVVLPCRTLGTPVPQVSWYLDG 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 24/99 (24%)
Ig 69..139 CDD:143165 16/71 (23%)
IG_like 165..249 CDD:214653 28/97 (29%)
IGc2 172..237 CDD:197706 22/65 (34%)
IG_like 267..348 CDD:214653 18/89 (20%)
Ig 270..339 CDD:299845 16/77 (21%)
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317 13/53 (25%)
I-set 91..184 CDD:254352 13/52 (25%)
I-set 190..279 CDD:254352 24/103 (23%)
Ig2_Robo 193..279 CDD:143201 22/100 (22%)
I-set 283..370 CDD:254352 25/91 (27%)
Ig 300..370 CDD:299845 22/72 (31%)
Ig 388..>457 CDD:299845 16/77 (21%)
I-set 479..561 CDD:254352 9/38 (24%)
Ig 496..561 CDD:143165 5/21 (24%)
FN3 588..681 CDD:238020
FN3 <817..856 CDD:238020
fn3 864..952 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.