DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and sns

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster


Alignment Length:403 Identity:100/403 - (24%)
Similarity:150/403 - (37%) Gaps:111/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GGSTLN--NVISEDPEFTDVIENITVPAGRNVKLACSV--KNLGSYKVAWMHFEQSAILTVHNHV 100
            ||:|||  .|:........|.|||.|..|.:..|:|:|  |.|....|.|......  :||....
  Fly   757 GGATLNITVVVEYGTTIKSVSENIVVNPGEDAMLSCTVEGKPLTEEHVKWERVGYD--MTVKTST 819

  Fly   101 ITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQI-NTVTAKTQYGFVKVV-VPPNIDDAL 163
            ...|             .|.:|||.:.:.||.|.:.|.. |.|...|....:.:| ..|.|....
  Fly   820 TFAN-------------GTSYLHIKDAKREDVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTP 871

  Fly   164 TSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKT--LEVHDLETDSLELE------R 220
            |........|:...|.|:|:|||:|...| |.|...:.||:|  .||.:.:.|||..|      :
  Fly   872 TLLRAASGTGERGRLPCRAQGSPKPQFIW-RQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDK 935

  Fly   221 ISRLHMGAYLCIASNGV----------------PPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFN 269
            ::....|||.|:|.|.:                ||.....:.|:.|...:.|.|        ||:
  Fly   936 VAPADYGAYECVARNELGEAVETVRLEITSQPDPPLSLNILNVTHDTVTLAWTP--------GFD 992

  Fly   270 ITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVA 334
            ..|:.         :|..|   ..:.:..:||  .|.|.|:   :.:|||..::.:....:..::
  Fly   993 GGLKA---------SYRVR---YRMADREQYK--YIDGLPN---SHKLTIGGLRMNTLYLFSVMS 1040

  Fly   335 KNPRGDMDGNIKLYM---------SSPPTTQP-------PPTTTTLRRTTTTAAEIALDGYINTP 383
            .|..|...     |:         .:||.:.|       ||||:                  .||
  Fly  1041 WNELGQSS-----YLPDLARAETKEAPPPSHPASSLGGGPPTTS------------------QTP 1082

  Fly   384 LNG-NGIGIVGEG 395
            |.| :|:.:||.|
  Fly  1083 LGGTSGMLLVGVG 1095

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 27/99 (27%)
Ig 69..139 CDD:143165 18/71 (25%)
IG_like 165..249 CDD:214653 29/107 (27%)
IGc2 172..237 CDD:197706 26/72 (36%)
IG_like 267..348 CDD:214653 15/80 (19%)
Ig 270..339 CDD:299845 12/68 (18%)
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 5/9 (56%)
IGc2 692..757 CDD:197706 100/403 (25%)
Ig 788..849 CDD:143165 19/75 (25%)
Ig 885..960 CDD:143165 25/75 (33%)
FN3 967..1051 CDD:238020 22/113 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.