DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Dscam3

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:466 Identity:97/466 - (20%)
Similarity:175/466 - (37%) Gaps:106/466 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GCLIASSVALSTDTG-----SEGNAGNVGGSTLNNVISEDPEFTDVIENITVP----AGRNVKLA 72
            |.|:..:|....|.|     ....||......:...::..|    |||....|    .|...::.
  Fly   594 GQLVIKNVEPGRDQGIYTCIVRSRAGEEARRDMQLNVNSPP----VIEPFKFPKNLQEGGRAQIT 654

  Fly    73 CSVKNLGSYKV--AWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRY 135
            |:|.: |...:  :|.. :.|:|.:          .:.:|..|.:.:.  .|...::.....|:|
  Fly   655 CAVSS-GDMPIYFSWKK-DDSSIPS----------SLQITEKKEEFYS--LLVFKDISARHSGKY 705

  Fly   136 MCQINTVTAKTQY-GFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNK 199
            .|..:...||..| ..::|.|.|..  .....|..:..|:.:::.|:|:|.|.|||.|.:..|..
  Fly   706 TCYASNAAAKVNYTAELQVRVAPRW--RYEPMDTAIMLGNTISINCEAEGYPIPTITWFKGQGKG 768

  Fly   200 IVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGI 264
               :|..:...:...||.|...:....|.|:|.|:|.:...:.|.|:::|:             .
  Fly   769 ---SKDFKPLSMRNHSLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVN-------------E 817

  Fly   265 PIGFN-------------ITLECFIEANPTSLNYWTRENDQMITESSKY-----KTETIPGHPSY 311
            |..|.             :||:|..:.:......||:.|.::...:.::     |||  .|..| 
  Fly   818 PARFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNFRFSIAEMKTE--KGVDS- 879

  Fly   312 KATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIAL 376
                :|||.:....|.|.|:|:|:||.|..:..|.|.:...|.|   |:...:....:...:::.
  Fly   880 ----QLTIGHSDRHDSGVYRCIAENPYGRAEQIIFLAVQERPDT---PSHLEIFEVGSRTVKLSW 937

  Fly   377 DGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEIDKSKQKLTGSSPKGFDWSKGKSSG 441
                ..|.:||       .|..|.:.. ..::|||.:...:          :..|.||       
  Fly   938 ----RRPFDGN-------SPVLSYLVQ-YQALKYLQSHGSL----------AAAGGDW------- 973

  Fly   442 SHGNLMASSWP 452
             :|:::..|.|
  Fly   974 -NGHVINVSLP 983

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 19/102 (19%)
Ig 69..139 CDD:143165 12/71 (17%)
IG_like 165..249 CDD:214653 22/83 (27%)
IGc2 172..237 CDD:197706 19/64 (30%)
IG_like 267..348 CDD:214653 24/98 (24%)
Ig 270..339 CDD:299845 21/73 (29%)
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706 5/24 (21%)
I-set 634..724 CDD:254352 21/107 (20%)
ig 645..712 CDD:278476 13/80 (16%)
IG_like 734..815 CDD:214653 22/83 (27%)
Ig 745..815 CDD:299845 20/72 (28%)
I-set 820..913 CDD:254352 25/99 (25%)
Ig 838..920 CDD:299845 25/91 (27%)
FN3 917..1033 CDD:238020 17/100 (17%)
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.