DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr15

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:465 Identity:102/465 - (21%)
Similarity:153/465 - (32%) Gaps:113/465 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDK 116
            |...|..:.|...||.:..|.|:||.|....::|:......||||.......:.|.......:.:
  Fly   190 PPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPE 254

  Fly   117 HRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCK 181
            .  |.|.|..||.:|.|.|.||::|....:....:::|.|..  :.:..|...|:.|..|.|||.
  Fly   255 R--WSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKT--ELIGESTRHVKAGSQVKLRCI 315

  Fly   182 AKGSPEPT--IKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKR 244
            ...:.||.  |.|       ....|.:.:|:......|:|||.   :.|.:...|.....:.:..
  Fly   316 ISQALEPPLFINW-------FYNQKQIYLHNRRGWRTEIERID---LPAEVPTTSTTTTTTTTTA 370

  Fly   245 IKVSVDFSPMVWIP--------------HQLVGIPIGFNITLECFIEANPTSLNYWTREND---- 291
            ...:...|.....|              ..|.|:   ..||....::|        ..:||    
  Fly   371 STTTTTTSTTPATPSTTATGSTEGATSSETLNGL---VTITRSYILDA--------ISQNDVSEL 424

  Fly   292 ---------------QMITE----SSKYKTETIPG-----HPSYKATMRLTITNVQSSDYGNYKC 332
                           |::||    ||...|.|..|     ..:|.|.....||...:.|......
  Fly   425 GAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAA 489

  Fly   333 VAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTA----AEIALD--GYINTPLNGNGIGI 391
            ........||.......::..||. .|:::.:::.||.:    |.:.||  .|..:|.|.....|
  Fly   490 TTSAWLTTMDAEAATTAATTTTTM-LPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNSAPRTI 553

  Fly   392 V-----GEGPTNSVIASGKSSIKYLSNLNEIDKSKQKLTGSSPKGFDWSKGKSSGSHGNLMASSW 451
            |     || .:.|.|.||..|                          ||  ...|.||.|   .|
  Fly   554 VLHVLNGE-YSASAIKSGSVS--------------------------WS--ALIGCHGYL---HW 586

  Fly   452 PLICCILALL 461
            ..:..:|.||
  Fly   587 RNVSTLLTLL 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/95 (26%)
Ig 69..139 CDD:143165 20/69 (29%)
IG_like 165..249 CDD:214653 19/85 (22%)
IGc2 172..237 CDD:197706 17/66 (26%)
IG_like 267..348 CDD:214653 20/108 (19%)
Ig 270..339 CDD:299845 18/96 (19%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 25/93 (27%)
V-set 204..290 CDD:284989 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.