DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr17

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:240 Identity:59/240 - (24%)
Similarity:97/240 - (40%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNH 99
            :.|:..||.:..      ..|..:.|||...|.:..:.|.:..|....|:|:....:.|::|...
  Fly   395 DGGDGAGSAVRR------NLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDET 453

  Fly   100 VITRNPRI-SVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINT---VTAKTQYGFVKVVVPPNID 160
            ....:.|. |:..:.||  .||.|.|..|:..|.|.|.||:.|   ::||..   :::|.|..  
  Fly   454 TFIADERFQSIYQEDHD--YTWSLQIKYVEPSDAGWYECQMATEPKLSAKVH---LQIVKPKT-- 511

  Fly   161 DALTSSDIIVREGDNVTLRCKAKGSPEPT--IKWKRDDGNKIV----------------INKTLE 207
            :.:......|:.|..|.|.|..:|:.:|.  |.|.|  |.|.:                |..|:.
  Fly   512 ELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFR--GQKKISDSDERTGWYTQLDRNIFGTVG 574

  Fly   208 VHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFS 252
            .:.....||.:..:.:...|.|.|..||.|..||...: :|.::|
  Fly   575 DNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHV-LSGEYS 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 27/99 (27%)
Ig 69..139 CDD:143165 19/70 (27%)
IG_like 165..249 CDD:214653 24/101 (24%)
IGc2 172..237 CDD:197706 20/82 (24%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 22/78 (28%)
Ig 415..507 CDD:299845 26/96 (27%)
IG_like 521..612 CDD:214653 24/92 (26%)
IGc2 524..605 CDD:197706 20/82 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.