DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Ama

DIOPT Version :10

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:332 Identity:87/332 - (26%)
Similarity:147/332 - (44%) Gaps:31/332 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWM-----HFEQSAILTVHNHVIT 102
            :|::|:|. |..:.:.:::....|.:|:..|:|:.:|...|:|.     ....|.:|::.|.:..
  Fly    25 SLDSVLSA-PVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSL 88

  Fly   103 RNPRISVTHDKHDK--HRTWFLHINNVQEEDRGRYMCQI-----NTVTAKTQYGFVKVVVPPNID 160
            .:.|.:||..:..|  ...:...|.|::..|.|.|.||:     ..||.|..   :::..||.|.
  Fly    89 PDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLS---LQIKTPPVIA 150

  Fly   161 DALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEV--HDLETDSLELERISR 223
            :. |....:|.||.|:.|.|.|.|.|:|||.|.|:.      |..:..  |.|...:|.:..:.|
  Fly   151 EN-TPKSTLVTEGQNLELTCHANGFPKPTISWAREH------NAVMPAGGHLLAEPTLRIRSVHR 208

  Fly   224 LHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTR 288
            :..|.|.|||.||......:.|:|.|:|.|.:.:....:...:..:..|||.::..|.....|.:
  Fly   209 MDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHK 273

  Fly   289 ENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPP 353
            ....:  :||::.........|...|..|.|.:|...|:|:|.|.|.|..|..|..:.|:.    
  Fly   274 NGVPL--QSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLFQ---- 332

  Fly   354 TTQPPPT 360
            |..|.|:
  Fly   333 TVIPVPS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 24/107 (22%)
Ig strand B 69..73 CDD:409353 1/3 (33%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 117..124 CDD:409353 0/6 (0%)
Ig 157..249 CDD:472250 31/93 (33%)
Ig strand B 176..180 CDD:409289 1/3 (33%)
Ig strand C 189..193 CDD:409289 2/3 (67%)
Ig strand E 213..218 CDD:409289 1/4 (25%)
Ig strand F 228..233 CDD:409289 2/4 (50%)
Ig strand G 242..245 CDD:409289 0/2 (0%)
IG_like 267..348 CDD:214653 20/80 (25%)
Ig strand C 283..287 CDD:409394 0/3 (0%)
Ig strand E 313..319 CDD:409394 2/5 (40%)
Ig strand F 329..334 CDD:409394 2/4 (50%)
AmaNP_731114.2 I-set 33..143 CDD:400151 25/112 (22%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 1/2 (50%)
Ig_3 146..220 CDD:464046 28/80 (35%)
I-set 254..330 CDD:400151 20/77 (26%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 312..317 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.