DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr16

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:292 Identity:61/292 - (20%)
Similarity:95/292 - (32%) Gaps:86/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPR------------------ 106
            |.||.||::..|.|.:.......::|:......|:.|.:.....:.|                  
  Fly   207 NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGA 271

  Fly   107 ISVT-------------------HDKHDKHRTWFLHINNVQEEDRGRYMCQINT---VTAKTQYG 149
            :|.|                   ...:....:|.|.|..|..||.|.|.||:.|   ::||.|. 
  Fly   272 LSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQL- 335

  Fly   150 FVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPT--IKWKRDDGNKIVINKTLEV---- 208
               .|:.|. .:.:......|:.|..|.|.|..:|:.|..  |.|.|.|......|:....    
  Fly   336 ---FVI
TPR-TELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGW 396

  Fly   209 -------------HDLET-DSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFS-----PM 254
                         |:..| .||.:..:.::|.|.|.|...|....|:...: :|.::|     ..
  Fly   397 YTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHV-LSGEYSASAIKST 460

  Fly   255 VWIPHQLVGIPIGFNITLECFIEANPTSLNYW 286
            ...||:|     |...          |||:.|
  Fly   461 AARPHRL-----GHGY----------TSLHQW 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 27/134 (20%)
Ig 69..139 CDD:143165 17/106 (16%)
IG_like 165..249 CDD:214653 22/103 (21%)
IGc2 172..237 CDD:197706 20/84 (24%)
IG_like 267..348 CDD:214653 5/20 (25%)
Ig 270..339 CDD:299845 4/17 (24%)
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 27/133 (20%)
Ig <298..338 CDD:299845 14/43 (33%)
IG_like 352..447 CDD:214653 22/94 (23%)
Ig 358..439 CDD:143165 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.