DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and LSAMP

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:307 Identity:98/307 - (31%)
Similarity:146/307 - (47%) Gaps:24/307 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKH 117
            :|....:||||..|....|.|.|::..| ||||::  :|.|:...:...:.:||:.: ..:|...
Human    33 DFNRGTDNITVRQGDTAILRCVVEDKNS-KVAWLN--RSGIIFAGHDKWSLDPRVEL-EKRHSLE 93

  Fly   118 RTWFLHINNVQEEDRGRYMCQINTV-TAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCK 181
              :.|.|..|...|.|.|.|.:.|. ..||...::.|.|||.|.:  .|||:.|.||.||||.|.
Human    94 --YSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISN--ISSDVTVNEGSNVTLVCM 154

  Fly   182 AKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIK 246
            |.|.|||.|.|:.       :..|....:.|.:.||:..|:|...|.|.|.|:|.|..:..|::|
Human   155 ANGRPEPVITWRH-------LTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVK 212

  Fly   247 VSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSY 311
            |:|::.|.: ...:......|...:|:|...|.|.....|.|: |..|..::..:.::..|..| 
Human   213 VTVNYPPTI-TESKSNEATTGRQASLKCEASAVPAPDFEWYRD-DTRINSANGLEIKSTEGQSS- 274

  Fly   312 KATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPP 358
                 ||:|||....||||.|||.|..|..:.::.|:....||...|
Human   275 -----LTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTIPHP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 29/96 (30%)
Ig 69..139 CDD:143165 20/69 (29%)
IG_like 165..249 CDD:214653 33/83 (40%)
IGc2 172..237 CDD:197706 25/64 (39%)
IG_like 267..348 CDD:214653 25/80 (31%)
Ig 270..339 CDD:299845 23/68 (34%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 28/95 (29%)
Ig 132..215 CDD:386229 35/91 (38%)
Ig_3 219..294 CDD:372822 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143409
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3058
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.