DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and rplp0

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_012813704.1 Gene:rplp0 / 394664 XenbaseID:XB-GENE-976211 Length:315 Species:Xenopus tropicalis


Alignment Length:154 Identity:25/154 - (16%)
Similarity:56/154 - (36%) Gaps:56/154 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 VTAKTQYGFVKVVVPPNIDDALTSSDI-IVREGDNVTLRCKAKGSPEPT---------------I 190
            :|.|...|.::::           ||: :::.||.|       |:.|.|               |
 Frog   144 ITTKISRGTIEIL-----------SDVQLIKTGDKV-------GASEATLLNMLNISPFSYGLII 190

  Fly   191 KWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMV 255
            :...|:|:..    :.||.|:..::|.:..:..:...|.:|:               .:.:..:.
 Frog   191 QQVYDNGSIY----SPEVLDITEEALHVRFLEGVRNVASVCL---------------QIGYPTVA 236

  Fly   256 WIPHQLVGIPIGFNITLECFIEAN 279
            .:||.::.   |:...|...:|.:
 Frog   237 SVPHSVIN---GYKRVLAIAVETD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 3/12 (25%)
Ig 69..139 CDD:143165
IG_like 165..249 CDD:214653 17/99 (17%)
IGc2 172..237 CDD:197706 15/79 (19%)
IG_like 267..348 CDD:214653 3/13 (23%)
Ig 270..339 CDD:299845 2/10 (20%)
rplp0XP_012813704.1 Ribosomal_L10_P0 <76..315 CDD:381979 25/154 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.