DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr13

DIOPT Version :10

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:231 Identity:62/231 - (26%)
Similarity:102/231 - (44%) Gaps:35/231 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSTDTGSEGNAGNVGGS-----TLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAW 85
            |..:.|.||...::.|:     |.|:.:            :|...|....:.|:|.::|...|:|
  Fly   157 LEANNGIEGGMESLFGTPMYFGTENSTV------------VTTQIGATAHVPCTVHHIGEGVVSW 209

  Fly    86 MHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGF 150
            :..:...:|||.....:.:.|.|.||.||.:  .|.|.|..||..|.|.|.||::|....:.:..
  Fly   210 IRKKDYHLLTVGLTTYSSDERFSATHLKHSE--DWTLQIKFVQLRDAGVYECQVSTHPPTSIFLH 272

  Fly   151 VKVVVPPNIDDALTSSDI-IVREGDNVTLRCKAKGSPEPT--IKWKRDDGNKIV-------INKT 205
            :.||   .....:|...| .:..|..:.|:|:...:.|.:  |.|..|  |:::       ||.:
  Fly   273 LSVV---EARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHD--NRMINYDIDRGINVS 332

  Fly   206 LEVHDLETDSLELERISRLHMGAYLCIASNGVPPSV 241
            .| .|.::..|.::|..|.|.|.:.|:|||..|.||
  Fly   333 TE-PDFQSSELTIQRTRREHSGNFTCVASNTQPASV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 28/95 (29%)
Ig strand B 69..73 CDD:409353 0/3 (0%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 117..124 CDD:409353 2/6 (33%)
Ig 157..249 CDD:472250 26/95 (27%)
Ig strand B 176..180 CDD:409289 1/3 (33%)
Ig strand C 189..193 CDD:409289 1/5 (20%)
Ig strand E 213..218 CDD:409289 1/4 (25%)
Ig strand F 228..233 CDD:409289 1/4 (25%)
Ig strand G 242..245 CDD:409289 62/231 (27%)
IG_like 267..348 CDD:214653
Ig strand C 283..287 CDD:409394
Ig strand E 313..319 CDD:409394
Ig strand F 329..334 CDD:409394
dpr13NP_001033956.2 V-set 180..276 CDD:462230 28/109 (26%)
Ig_3 281..361 CDD:464046 21/82 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.