DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr13

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:231 Identity:62/231 - (26%)
Similarity:102/231 - (44%) Gaps:35/231 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSTDTGSEGNAGNVGGS-----TLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAW 85
            |..:.|.||...::.|:     |.|:.:            :|...|....:.|:|.::|...|:|
  Fly   157 LEANNGIEGGMESLFGTPMYFGTENSTV------------VTTQIGATAHVPCTVHHIGEGVVSW 209

  Fly    86 MHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGF 150
            :..:...:|||.....:.:.|.|.||.||.:  .|.|.|..||..|.|.|.||::|....:.:..
  Fly   210 IRKKDYHLLTVGLTTYSSDERFSATHLKHSE--DWTLQIKFVQLRDAGVYECQVSTHPPTSIFLH 272

  Fly   151 VKVVVPPNIDDALTSSDI-IVREGDNVTLRCKAKGSPEPT--IKWKRDDGNKIV-------INKT 205
            :.||   .....:|...| .:..|..:.|:|:...:.|.:  |.|..|  |:::       ||.:
  Fly   273 LSVV---EARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHD--NRMINYDIDRGINVS 332

  Fly   206 LEVHDLETDSLELERISRLHMGAYLCIASNGVPPSV 241
            .| .|.::..|.::|..|.|.|.:.|:|||..|.||
  Fly   333 TE-PDFQSSELTIQRTRREHSGNFTCVASNTQPASV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 28/95 (29%)
Ig 69..139 CDD:143165 23/69 (33%)
IG_like 165..249 CDD:214653 25/87 (29%)
IGc2 172..237 CDD:197706 21/73 (29%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
dpr13NP_001033956.2 V-set 180..276 CDD:284989 28/109 (26%)
IG_like 182..262 CDD:214653 26/93 (28%)
IG_like 285..362 CDD:214653 21/79 (27%)
IGc2 292..361 CDD:197706 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.