DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Gm1123

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001074245.1 Gene:Gm1123 / 382097 MGIID:2685969 Length:390 Species:Mus musculus


Alignment Length:371 Identity:84/371 - (22%)
Similarity:137/371 - (36%) Gaps:89/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 YMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEP----TIKWKRD 195
            ::|.:.     ...|.|.:..|..     |..::   :|:.|.|.|....|||.    .|:|.|.
Mouse     9 FLCGVT-----DHIGSVSITTPEQ-----TIQEV---QGETVHLPCMFTLSPEDQGPLDIEWLRL 60

  Fly   196 DG-------NKIVINKTLEVH-DLETD-----------------SLELERISRLHMGAYLCIASN 235
            .|       :.|::....::: |...|                 |:::..:.....|.|||....
Mouse    61 SGPNNEAMDHVIILYAVDKIYSDFYQDMRGRVNFTSNGITSGEASIKIRDVQPADSGTYLCKVKT 125

  Fly   236 GVPPSVSK-RIKVS-VDF--SPMVWIPHQLVGIPIGFNITLEC---FIEANPTSLNY-WTR---- 288
            .  |.|:| .:::: ||:  |..:..|.|.:....|..:.|.|   ||..:...||. |.|    
Mouse   126 A--PGVAKTTVQLTVVDYIGSVSITTPEQTIEKDQGETVHLPCMFTFISKDQGPLNIEWLRLSGP 188

  Fly   289 ENDQMITESSKYKTETIPG--HPSYKATMRLT------------ITNVQSSDYGNYKCVAKNPRG 339
            .|:.|......|..:.|..  :|..|..:..|            |||||.||.|.|:|..|...|
Mouse   189 NNEAMDHVVILYSADKIHDDVYPDLKGRVYFTSNDIKSGDASINITNVQLSDAGTYQCKVKTYPG 253

  Fly   340 DMDGNIKL----YMSSPPTTQPPPTTTTLR-RTTTTAAEIALDGYINTPLNGNGIGIVGEGPTNS 399
            .::.|::|    ::.|...|.|..|....| .|........|....:.||..:.:.:.  ||.|.
Mouse   254 TVNRNLQLAVTDHIGSVSITTPEQTIQKARGETVHLPCTFTLSPEDHGPLFIDWMQLT--GPQNE 316

  Fly   400 VIASGKSSIKYLS-----NLNEIDKSKQKLTGSSPKGFDWSKGKSS 440
            |:  .:..|.||:     |..:..|.:.:.|.:     |...|::|
Mouse   317 VV--NRMFIVYLADKIYDNFYQDMKGRVQFTSN-----DIRSGEAS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 3/19 (16%)
Ig 69..139 CDD:143165 1/3 (33%)
IG_like 165..249 CDD:214653 22/114 (19%)
IGc2 172..237 CDD:197706 19/93 (20%)
IG_like 267..348 CDD:214653 30/106 (28%)
Ig 270..339 CDD:299845 26/90 (29%)
Gm1123NP_001074245.1 V-set 24..139 CDD:284989 24/124 (19%)
IG_like 25..138 CDD:214653 24/122 (20%)
V-set 149..264 CDD:284989 32/114 (28%)
IG_like 152..263 CDD:214653 31/110 (28%)
V-set 274..389 CDD:284989 20/91 (22%)
IG_like 277..388 CDD:214653 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.