DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and robo1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:363 Identity:93/363 - (25%)
Similarity:138/363 - (38%) Gaps:63/363 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSP 186
            |.|:||:..|.|.|.|....:....:..:.|::|...........|.::..|...|..|...|.|
  Fly   218 LLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIV
QVKPYFMKEPKDQVMLYGQTATFHCSVGGDP 282

  Fly   187 EPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDF 251
            .|.:.||:::|| |.:::...:||  ..|||:..|:....|.|:|.|.|.|.       ::|...
  Fly   283 PPKVLWKKEEGN-IPVSRARILHD--EKSLEISNITPTDEGTYVCEAHNNVG-------QISARA 337

  Fly   252 SPMVWIPHQLVGIP----IGFN--ITLECFIEANPTSLNYWTRE--NDQMITESSKYKTETIPGH 308
            |.:|..|......|    :|.|  :.|.|....||....:||:|  :..|...||.       |.
  Fly   338 SLIVHAPPNFTKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSH-------GR 395

  Fly   309 PSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSS-----PPTTQPPPTTTTL---- 364
            ....|...|.||:|:..|.|.|.|.|.:........:.|.:||     ||..|..|...||    
  Fly   396 QHVAADGTLQITDVRQEDEGYYVCSAFSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGS 460

  Fly   365 ------RRTTTTAAEIAL--DGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEIDKSK 421
                  |.|...:..|..  ||:           .|..|...|:|..  ||:: :.:|...|...
  Fly   461 VATLPCRATGNPSPRIKWFHDGH-----------AVQAGNRYSIIQG--SSLR-VDDLQLSDSGT 511

  Fly   422 QKLTGSSPKG-FDWS------KGKSSGSHGNLMASSWP 452
            ...|.|..:| ..|:      |..|:..|.....|::|
  Fly   512 YTCTASGERGETSWAATLTVEKPGSTSLHRAADPSTYP 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 9/32 (28%)
Ig 69..139 CDD:143165 8/16 (50%)
IG_like 165..249 CDD:214653 24/83 (29%)
IGc2 172..237 CDD:197706 22/64 (34%)
IG_like 267..348 CDD:214653 23/84 (27%)
Ig 270..339 CDD:299845 21/70 (30%)
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352 9/32 (28%)
Ig2_Robo 159..251 CDD:143201 9/32 (28%)
I-set 255..341 CDD:254352 26/95 (27%)
Ig3_Robo 272..341 CDD:143202 24/78 (31%)
IG_like 351..436 CDD:214653 25/91 (27%)
Ig 362..444 CDD:299845 24/88 (27%)
I-set 445..531 CDD:254352 22/99 (22%)
IGc2 459..521 CDD:197706 15/75 (20%)
FN3 549..637 CDD:238020 1/1 (100%)
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.