DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and wrapper

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:354 Identity:95/354 - (26%)
Similarity:148/354 - (41%) Gaps:48/354 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CLIASSVALSTDTGSEGNAGNVGGS-TLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSY 81
            ||:|:.:           .|.|... ..||.:....:|..:...:.......|:|.|::.....|
  Fly    11 CLLAALI-----------LGQVQAELDFNNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRY 64

  Fly    82 KVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTW---FLHINNVQEEDRGRYMCQINTVT 143
             |.| |.:..|:      |.:|:|.:    ...|:...|   .|.:.|||..|.|.|.|::|:.:
  Fly    65 -VRW-HRDDVAL------VDSRHPEL----PPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNSDS 117

  Fly   144 AK-TQYGFVKVVVPPNIDDALTSSDII-VREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTL 206
            .. .|...::|.:.|.:  .:..||:. .|.|....:.|:|:|.|:|.|.| |.:||  ||....
  Fly   118 GHVVQQHAIEVQLAPQV--LIEPSDLTEQRIGAIFEVVCEAQGVPQPVITW-RLNGN--VIQPQS 177

  Fly   207 EVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNIT 271
            ...:.:  ||.||..||...|...|:|||||.......:.:.|.|||.|.||..:|...:|....
  Fly   178 NTGNRQ--SLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAH 240

  Fly   272 LECFIEANPTSLNYWTRE------NDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNY 330
            |||.:||.|.:...|...      .....|..|:.:|.....|........|.:.:|:::|.|.|
  Fly   241 LECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQY 305

  Fly   331 KCVAKNPRGDMDGNIKLYMSSPPTTQPPP 359
            :|.|.|......|:::|      |.:|.|
  Fly   306 ECRASNQISVKSGSVEL------TGRPMP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 24/99 (24%)
Ig 69..139 CDD:143165 21/72 (29%)
IG_like 165..249 CDD:214653 29/84 (35%)
IGc2 172..237 CDD:197706 24/64 (38%)
IG_like 267..348 CDD:214653 21/86 (24%)
Ig 270..339 CDD:299845 19/74 (26%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 23/94 (24%)
IG_like 41..118 CDD:214653 22/88 (25%)
IG_like 145..218 CDD:214653 27/77 (35%)
Ig 147..219 CDD:299845 26/76 (34%)
I-set 224..323 CDD:254352 26/104 (25%)
IGc2 236..314 CDD:197706 20/77 (26%)
FN3 339..431 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.