DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and fra

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523716.2 Gene:fra / 36377 FlyBaseID:FBgn0011592 Length:1526 Species:Drosophila melanogaster


Alignment Length:536 Identity:121/536 - (22%)
Similarity:183/536 - (34%) Gaps:152/536 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GCLIASSVALSTDTGSEGNAGNVG-----------GSTLNN----VISEDPEFT-DVIENITVPA 65
            |.|..|||        |.|.|..|           ||.|:.    .|...|:.. |.:|...:| 
  Fly   102 GSLYISSV--------EENRGLTGAYQCLLTAEGVGSILSRPALVAIVRQPDLNQDFLETYLLP- 157

  Fly    66 GRNVKLACSVKNLG-----SYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHIN 125
            |:.....|.:....     .:.|.|:..:....|.....|:..|..               |.|:
  Fly   158 GQTAYFRCMLGEANWQEGVKHSVQWLKDDLPLPLDKLRMVVLPNGA---------------LEID 207

  Fly   126 NVQEEDRGRYMCQINT-----VTAKTQYGFVKVVVPPNIDDALTSSDII------VREGDNVTLR 179
            .|...|||.|.|.:.:     :::||... :|....|..::::..|.::      |||||.|||.
  Fly   208 EVGPSDRGSYQCNVTSGSSSRLSSKTNLN-IKKPSDPGAENSVAPSFLVGPSPKTVREGDTVTLD 271

  Fly   180 CKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLE-------TDSLELERISRLHMGAYLCIASNGV 237
            |.|.|.|:|.|||.|:       ...|:.:||:       |.||::.....:..|.|.|.|||.|
  Fly   272 CVANGVPKPQIKWLRN-------GMDLDFNDLDSRFSIVGTGSLQISSAEDIDSGNYQCRASNTV 329

  Fly   238 PPSVSKRIKVSVDFSPMVWI--PHQLVGIPIGFNI------TLECFIEANPTSLNYWTRENDQMI 294
            .         |:|....|.:  |.:.:..|.....      .|:|.|...|..:..|.:..| :|
  Fly   330 D---------SLDAQATVQVQEPPKFIKAPKDTTAHEKDEPELKCDIWGKPKPVIRWLKNGD-LI 384

  Fly   295 TESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDG-----------NIKLY 348
            |.:.  ..:.:.||       .|.|..:.:||.|.::||..|..|.:..           .||..
  Fly   385 TPND--YMQLVDGH-------NLKILGLLNSDAGMFQCVGTNAAGSVHAAARLRVVPQGVKIKKR 440

  Fly   349 MSSPPTTQPPPT--TTTLRR------------------------------TTTTAAEIALDGYI- 380
            .|...:|:...|  ..|.||                              :.||...|. .|.: 
  Fly   441 KSQGHSTKSLQTFDNLTKRRKPFNSGEQLRTKSGGSFPFPDEDDDLDDNDSGTTRLRIP-SGKLP 504

  Fly   381 --NTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEIDKSKQKLTGSSPKGFD-------WSK 436
              ..|||.....|:..|....:....||......:.:|.|.:|:.|..:..:|.|       |.:
  Fly   505 KFEQPLNDRRFNILNAGSALPLDNQSKSYEDDDDDYDEDDPAKEALLEAYKQGEDAHKILDSWQQ 569

  Fly   437 GKSSGSHGNLMASSWP 452
            .||..|.....:.:.|
  Fly   570 SKSKKSQQQKQSPASP 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 20/105 (19%)
Ig 69..139 CDD:143165 14/74 (19%)
IG_like 165..249 CDD:214653 31/96 (32%)
IGc2 172..237 CDD:197706 27/71 (38%)
IG_like 267..348 CDD:214653 21/97 (22%)
Ig 270..339 CDD:299845 18/74 (24%)
fraNP_523716.2 Ig 36..140 CDD:299845 12/45 (27%)
Ig <180..222 CDD:299845 13/56 (23%)
IG_like 257..340 CDD:214653 33/98 (34%)
IGc2 264..327 CDD:197706 25/69 (36%)
I-set 344..430 CDD:254352 20/95 (21%)
Ig 363..428 CDD:299845 19/74 (26%)
FN3 611..703 CDD:238020
FN3 711..799 CDD:238020
FN3 806..897 CDD:238020
FN3 908..989 CDD:238020
FN3 1011..1097 CDD:238020
FN3 1109..1205 CDD:238020
Neogenin_C 1273..1521 CDD:284094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.