DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Sdk2

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 / 360652 RGDID:1310397 Length:2175 Species:Rattus norvegicus


Alignment Length:407 Identity:98/407 - (24%)
Similarity:162/407 - (39%) Gaps:91/407 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YHLEAISSFLYVGLGCLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIE-NITVPAG 66
            |..||:          |.:||||..|           .|:.|:  :.|.|:|....| :||....
  Rat   285 YECEAM----------LRSSSVAPVT-----------RGAYLS--VLEPPQFVREPERHITAEME 326

  Fly    67 RNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRT-WFLHINNVQEE 130
            :.|.:.|..|.:....:.|  ::.:|::.|..  :||           .|.|: ..|.|:.:..:
  Rat   327 KVVDIPCRAKGVPPPSITW--YKDAALVEVGK--LTR-----------FKQRSDGGLQISGLLPD 376

  Fly   131 DRGRYMCQINTVTAKTQYGFVKVV--VPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWK 193
            |.|...|..:....:.|......|  :.|||......|.:|  :|.:|.|.|:..|:|.|.|.|:
  Rat   377 DTGMVQCFAHNAAGEAQTSTYLAVTSIAPNITRGPLDSTVI--DGMSVVLACETSGAPRPAITWQ 439

  Fly   194 RDDGNKIVINKTLEVHD---LETDSLELERISRLHM---GAYLCIASN--GVPPSVSKRIKVSVD 250
            :  |.:|:.:.::::..   ||:.||   .||..|:   |.|.|:|:|  ||.       :.|.|
  Rat   440 K--GERILASGSVQLPRFTLLESGSL---LISPTHISDAGTYTCLATNSRGVD-------EASAD 492

  Fly   251 FSPMVWI------PHQLVGIPIGFNITLECFIEANP-TSLNY-WTRENDQMITESSKYKTETIPG 307
            .  :||.      |.|...:..|...::.|.:..:| .::.| |.::...:..|:          
  Rat   493 L--VVWARTRITKPPQDQSVIKGTQASMVCGVTHDPRVTVRYVWEKDGATLAVET---------- 545

  Fly   308 HPSYKATMR--LTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPP--TTQPPPTTTTL-RRT 367
            :|..:....  |.|:...|.|.|.|.|...:..|:...|..|.:...|  ...|..|.:|: ||.
  Rat   546 NPRIRLDRNGSLHISQTWSGDIGTYTCRVLSAGGNDSRNAHLRVRQLPHAPEHPVATLSTMERRA 610

  Fly   368 TTTAAEIALDGYINTPL 384
            .........||  |:||
  Rat   611 INLTWAKPFDG--NSPL 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 20/99 (20%)
Ig 69..139 CDD:143165 15/70 (21%)
IG_like 165..249 CDD:214653 27/91 (30%)
IGc2 172..237 CDD:197706 23/72 (32%)
IG_like 267..348 CDD:214653 16/84 (19%)
Ig 270..339 CDD:299845 13/72 (18%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653
IGc2 43..101 CDD:197706
IG_like 123..206 CDD:214653
Ig 135..191 CDD:299845
IG_like 225..307 CDD:214653 11/44 (25%)
IGc2 236..289 CDD:197706 1/3 (33%)
I-set 311..400 CDD:254352 21/103 (20%)
Ig 329..397 CDD:143165 16/82 (20%)
I-set 405..495 CDD:254352 32/105 (30%)
Ig 419..495 CDD:299845 27/89 (30%)
Ig 505..589 CDD:299845 18/93 (19%)
IG_like 505..589 CDD:214653 18/93 (19%)
FN3 593..684 CDD:238020 11/35 (31%)
FN3 696..789 CDD:238020
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.