DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Dscam1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:430 Identity:103/430 - (23%)
Similarity:163/430 - (37%) Gaps:94/430 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VGGSTL--NNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKV----AWMHFEQSAILTVH 97
            |.|:.:  :.|:.:..::..|:.|..  .|.:|:...:|....|.|:    ..:.|.:.|:.|..
  Fly   307 VSGTLIIKDAVVEDSGKYLCVVNNSV--GGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQ 369

  Fly    98 NHVITRNPRISVTHDKHDK---HRTWFLHINNVQEEDRGRYMCQI----NTVTAKTQYGFVKVVV 155
               .|.||..:|:..|..|   |....|.|.:|::||:|.|.|.:    .:..|..:........
  Fly   370 ---YTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLGGRFD 431

  Fly   156 PPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLET---DSLE 217
            ||.|..|.  .:..:..|.:|.|:|.|.|:|.|.|.|:. ||.||..|...:|....|   |.:.
  Fly   432 PPVIRQAF--QEETMEPGPSVFLKCVAGGNPTPEISWEL-DGKKIANNDRYQVGQYVTVNGDVVS 493

  Fly   218 LERISRLHM---GAYLCIASNGVPPSVSKR-IKVSVDFSPMVWIPHQL--VGIPIGFNITLECFI 276
            ...|:.:|.   |.|.|||.:.|  .|::. .|::|...|.:   .|:  ..|..|..:.:.|.:
  Fly   494 YLNITSVHANDGGLYKCIAKSKV--GVAEHSAKLNVYGLPYI---RQMEKKAIVAGETLIVTCPV 553

  Fly   277 EANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQ-SSDYGNYKCVAKNPRG- 339
            ...|.....|.|:|..:   ....|.:..|..       .|.|.||: :||...|.|||||..| 
  Fly   554 AGYPIDSIVWERDNRAL---PINRKQKVFPNG-------TLIIENVERNSDQATYTCVAKNQEGY 608

  Fly   340 DMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDGYINTPLNGNGIGIVGEGPTNSVIASG 404
            ...|::::.:...|...|                .|.:..||          :|:          
  Fly   609 SARGSLEVQVMVLPQIVP----------------FAYEDLIN----------MGD---------- 637

  Fly   405 KSSIKYLSNLNEIDKSKQKLTGSSPKGFDWSKGKSSGSHG 444
                       .||...|...|..|....||..:|:|.:|
  Fly   638 -----------SIDLFCQIQKGDRPIKVHWSFERSAGDYG 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/106 (24%)
Ig 69..139 CDD:143165 22/76 (29%)
IG_like 165..249 CDD:214653 28/90 (31%)
IGc2 172..237 CDD:197706 25/70 (36%)
IG_like 267..348 CDD:214653 22/82 (27%)
Ig 270..339 CDD:299845 19/69 (28%)
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653 7/37 (19%)
Ig 269..340 CDD:143165 7/34 (21%)
IG_like 353..425 CDD:214653 19/74 (26%)
IGc2 361..413 CDD:197706 17/54 (31%)
I-set 433..527 CDD:254352 31/98 (32%)
IGc2 446..517 CDD:197706 26/73 (36%)
I-set 533..618 CDD:254352 24/97 (25%)
IGc2 544..607 CDD:197706 20/72 (28%)
Ig 641..714 CDD:143165 8/26 (31%)
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.