DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and cntn1a

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_851300.2 Gene:cntn1a / 353150 ZFINID:ZDB-GENE-030427-1 Length:1032 Species:Danio rerio


Alignment Length:504 Identity:115/504 - (22%)
Similarity:182/504 - (36%) Gaps:135/504 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SEGN-----------AGN---VGGSTLNNVISE---------DPEFTDVIENITVPAGRNVKLAC 73
            ||||           |||   |..:...:|.|.         |...||..|.:.|..|:...|.|
Zfish   102 SEGNLLISSPDKSKHAGNYTCVASNQYGSVTSRRARVQFGYLDMFSTDEREAVYVKEGQGAVLLC 166

  Fly    74 SVKNLGSYKVAWMHFEQSA----ILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGR 134
            :..         .||.:..    :|......|..:.|..|:..      |..|:|:.|:..|.|.
Zfish   167 APP---------PHFPEDLSFRWMLNEFPEFIPLDQRRFVSQS------TGNLYISTVRSTDSGN 216

  Fly   135 YMCQINT-VTAKTQYG-FVKVVVPPNIDDALTS--SDIIVRE-------GDNVTLRCKAKGSPEP 188
            |.|.::: ..||:.:. |:.:|  |..:.:|..  :||.|:.       |.|:||.|.|.|:|.|
Zfish   217 YSCFVSSPAIAKSVFSKFIPLV--PIAERSLRKYPADIKVKSPDSWALLGQNITLECFALGNPIP 279

  Fly   189 TIKWKRDDGNKIVINKTLEVHDLETDS--LELERISRLHMGAYLCIASNGVPPSVSK---RIKVS 248
            .|:|::.||    :...|. ||:....  |.|..:.....|.|.|.|.|    |..|   :..:.
Zfish   280 QIRWRKLDG----VLPPLR-HDVSMSGALLHLYSLQYEDEGLYECEADN----SKGKDWHKTHLY 335

  Fly   249 VDFSPMVWIPHQLVG--IPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSY 311
            |:.:| .|: .|:..  :.||.:..:.|.....|....::.:.                 || .|
Zfish   336 VEGAP-DWL-EQISSSEVDIGGDYIMSCQASGKPKPHVHFLKN-----------------GH-MY 380

  Fly   312 KATMRLTITNVQSSDYGNYKCVAKNPRGDMDGN--IKLYMSSP---------------------- 352
            .....:..:.:...|.|.|:|||:|..|.:..|  ::::.|:|                      
Zfish   381 MKGHEVRFSRLGFEDSGMYQCVAENRHGVIHANAELRVFASAPSFQYNPVKPKLLGARNGRVVFE 445

  Fly   353 --PTTQPPPTTTTLRRT----TTTAAEIALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYL 411
              |...|.|..|..:.|    .::...|.|||.:.. ||   |....||.......:.:......
Zfish   446 CRPRAAPRPNITWSKGTELLHNSSRISIWLDGSLEL-LN---ISKSDEGKYTCFAENDRGRANST 506

  Fly   412 SNLNEIDKSKQKLTGSSPKGFDWSKGKSS-----GSH--GNLMASSWPL 453
            .:|:..|.:|..|   :|...|.|.|:.:     .||  |..:...|.|
Zfish   507 GSLSITDATKITL---APSNADVSVGEDARMECVASHDPGLDLTFIWSL 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 22/101 (22%)
Ig 69..139 CDD:143165 16/73 (22%)
IG_like 165..249 CDD:214653 28/97 (29%)
IGc2 172..237 CDD:197706 23/73 (32%)
IG_like 267..348 CDD:214653 15/82 (18%)
Ig 270..339 CDD:299845 12/68 (18%)
cntn1aNP_851300.2 Ig 45..136 CDD:299845 10/33 (30%)
I-set 46..134 CDD:254352 9/31 (29%)
Ig 142..237 CDD:299845 25/109 (23%)
IG_like 154..229 CDD:214653 19/89 (21%)
Ig 249..337 CDD:299845 28/96 (29%)
IG_like 256..336 CDD:214653 25/88 (28%)
Ig 341..418 CDD:299845 18/95 (19%)
IG_like 347..418 CDD:214653 16/88 (18%)
I-set 423..511 CDD:254352 16/91 (18%)
Ig5_Contactin_like 440..511 CDD:143170 15/74 (20%)
I-set 516..611 CDD:254352 11/40 (28%)
Ig 530..611 CDD:299845 5/23 (22%)
FN3 627..714 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 699..729
FN3 723..816 CDD:238020
FN3 825..905 CDD:214495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 907..926
FN3 920..1001 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.