DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and DIP-iota

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:332 Identity:143/332 - (43%)
Similarity:200/332 - (60%) Gaps:22/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKV 83
            |:..||..|..:.||          |||   .||:|:..|.|.|||.||:..|.|.|.:|.|:||
  Fly    11 LLLQSVCFSQASFSE----------LNN---SDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKV 62

  Fly    84 AWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQY 148
            ||:..:...||::.|||||:|.|||::   |.:||.|.|.|.:|||.|||.|||||||...|:|.
  Fly    63 AWLRVDTQTILSIQNHVITKNHRISIS---HTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQM 124

  Fly   149 GFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINK--TLEVHDL 211
            |::.|||||:|.|..||.|::...|.||||.|.|.|.|.|||.|:|::...|:|:.  ..||..:
  Fly   125 GYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSV 189

  Fly   212 ETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFI 276
            |..:|.|.::.|.|||||||||||||||:||||:.:.|:|:|.:|..:..:.:.:|..:||||..
  Fly   190 EGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECIT 254

  Fly   277 EANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDM 341
            |:.|.|:|:|.|  |..:.:...|  |::.....::..||:|:..:...|:|.|.|.|||..|..
  Fly   255 ESQPASVNFWLR--DSQLLQGGSY--ESVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQT 315

  Fly   342 DGNIKLY 348
            |..|.::
  Fly   316 DRIITVH 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 49/95 (52%)
Ig 69..139 CDD:143165 35/69 (51%)
IG_like 165..249 CDD:214653 43/85 (51%)
IGc2 172..237 CDD:197706 33/66 (50%)
IG_like 267..348 CDD:214653 27/80 (34%)
Ig 270..339 CDD:299845 23/68 (34%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 47/88 (53%)
Ig 39..122 CDD:299845 45/85 (53%)
Ig 132..213 CDD:299845 38/80 (48%)
IG_like 141..227 CDD:214653 43/85 (51%)
IG_like 239..322 CDD:214653 27/86 (31%)
IGc2 245..313 CDD:197706 24/71 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442844
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102261at50557
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
98.800

Return to query results.
Submit another query.