DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and itgb4

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 / 335269 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio


Alignment Length:398 Identity:68/398 - (17%)
Similarity:124/398 - (31%) Gaps:123/398 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLA-CSVKNLGSYKVAWMHFEQSAILTV 96
            |.....|..||.:....:..::..|..:::..||...|:. ..:..||         ||..:|  
Zfish  1019 EDGRAQVTYSTADLTAKDKKDYISVDGDLSYGAGETEKIVPVKLLELG---------EQDGLL-- 1072

  Fly    97 HNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDR-GRYMCQINTVTAKTQ---YGFVKVVVPP 157
                          .||..|.  :.:.:.|.::..: |||...:.|:..|.:   ..|.|.....
Zfish  1073 --------------EDKQVKQ--FVMDLTNPRQSAKLGRYPRTVITIADKPESSVMAFKKSTQTF 1121

  Fly   158 NIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERIS 222
            :..|:|.:.. :.|.|:..|         ..|:.|:.:..::..|:..|:.              
Zfish  1122 STTDSLYTIP-VERTGNRET---------PATVHWRTNKASRFDISSPLKF-------------- 1162

  Fly   223 RLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWT 287
                          .|....|.|.::....|...||.:       ||:.|   ::.:..::....
Zfish  1163 --------------APGEAEKNILINPRTHPSPIIPEK-------FNLEL---LDPSNNAIIGKR 1203

  Fly   288 RENDQMIT-----------ESSKYKTETI--PGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRG 339
            :..:.::|           :..:|.|:|.  ||...|..              .|.|.||..|: 
Zfish  1204 KTTEVIVTDGRGDGKNQDFQKMEYVTQTATSPGGRLYSP--------------ANIKAVATGPK- 1253

  Fly   340 DMDGNIKLYMSSPPTTQ----------PPPTTTTLRRTTTTAAEIA-LDGYINTPLNGNGIGIVG 393
                ||:|.........          .|..........|..||:. ||.|.:..:...|...:|
Zfish  1254 ----NIRLNWKPSQNANGYKVKYWIYGDPEDKAKFMDVKTPQAELTNLDPYCDYEMRVCGYNALG 1314

  Fly   394 EGPTNSVI 401
            :|..:.:|
Zfish  1315 DGNYSDII 1322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 19/100 (19%)
Ig 69..139 CDD:143165 13/71 (18%)
IG_like 165..249 CDD:214653 10/83 (12%)
IGc2 172..237 CDD:197706 6/64 (9%)
IG_like 267..348 CDD:214653 17/93 (18%)
Ig 270..339 CDD:299845 13/81 (16%)
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776
EGF_2 <468..490 CDD:285248
EGF_2 545..573 CDD:285248
Integrin_B_tail 625..709 CDD:285239
Calx-beta 991..1064 CDD:295344 8/44 (18%)
FN3 1242..1326 CDD:238020 19/100 (19%)
FN3 1331..1420 CDD:238020
fn3 1640..1720 CDD:278470
fn3 1751..1835 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.