DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and AgaP_AGAP009245

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_553184.3 Gene:AgaP_AGAP009245 / 3291935 VectorBaseID:AGAP009245 Length:203 Species:Anopheles gambiae


Alignment Length:200 Identity:50/200 - (25%)
Similarity:73/200 - (36%) Gaps:41/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TLNNVISEDPEF-TDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPR 106
            |..:.:...|.| .....|:|...|....|.|.|:|||:..|:|:......:|||.....|.:.|
Mosquito    31 TAKSPLDRGPYFDISASRNVTALVGNTAYLNCRVRNLGNRTVSWIRHRDLHLLTVGKATYTSDQR 95

  Fly   107 ISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVR 171
            ....|  :.:...|.|.:...|:.|.|.|.|||:|             .||              
Mosquito    96 YQSVH--NPQLDDWSLKVLYPQQRDSGVYECQIST-------------TPP-------------- 131

  Fly   172 EGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNG 236
            .|.::||..:        |.:....|...||.   |..|:.|..|.::|......|.|.|:.|..
Mosquito   132 VGYSMTLSVE--------INYDSPRGGVSVIT---EKGDITTSYLLIQRARSTDSGKYTCLPSMA 185

  Fly   237 VPPSV 241
            .|.:|
Mosquito   186 NPTTV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 27/95 (28%)
Ig 69..139 CDD:143165 21/69 (30%)
IG_like 165..249 CDD:214653 17/76 (22%)
IGc2 172..237 CDD:197706 16/64 (25%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
AgaP_AGAP009245XP_553184.3 Ig 47..140 CDD:299845 32/121 (26%)
IG_like 47..140 CDD:214653 32/121 (26%)
IG_like 127..>180 CDD:214653 17/90 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.