DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and AgaP_AGAP006350

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_557013.3 Gene:AgaP_AGAP006350 / 3290147 VectorBaseID:AGAP006350 Length:319 Species:Anopheles gambiae


Alignment Length:219 Identity:50/219 - (22%)
Similarity:85/219 - (38%) Gaps:38/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DPEF-TDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKH 114
            :|:| ..|..|:||..|....|.|.|:||..|.::|:......||.::....|.:.|....:  :
Mosquito    38 EPQFDLSVSRNVTVREGETAFLTCRVENLAKYSISWVRHHDLHILAINADTFTSDERFQALY--N 100

  Fly   115 DKHRTWFLHINNVQEEDRGRYMCQINTVTAKT--------QYGFVKVVVPPNIDDALTSSDIIVR 171
            |:...|.|.:...:.:|...|.|||:|:..|:        .|.|:....     ..|..:.:...
Mosquito   101 DQTAEWTLKLRRTRRKDTDIYECQISTMPVKSLQLYLIVLDYHFLTTTT-----QILEGTIVYGY 160

  Fly   172 EGDNVTLRCKAKGS----PEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHM------ 226
            :|.||.|.|....:    |...:.:.:.|   ||..::|.    :.....|..|:..|:      
Mosquito   161 KGQNVNLTCIVNHNYDRRPSHIVWYHQKD---IVAYESLR----KRGRSSLNSITSYHLIRSAEF 218

  Fly   227 ---GAYLCIASNGVPPSVSKRIKV 247
               |.|.|...  :.||.|..:.:
Mosquito   219 DDAGNYTCAPE--LYPSASTIVHI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 27/103 (26%)
Ig 69..139 CDD:143165 17/69 (25%)
IG_like 165..249 CDD:214653 19/96 (20%)
IGc2 172..237 CDD:197706 16/77 (21%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
AgaP_AGAP006350XP_557013.3 Ig 45..139 CDD:299845 26/95 (27%)
IG_like 46..126 CDD:214653 22/81 (27%)
IG_like 157..227 CDD:214653 15/76 (20%)
Ig 165..>226 CDD:143165 13/67 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.