DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr18

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:300 Identity:69/300 - (23%)
Similarity:109/300 - (36%) Gaps:81/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMH--FEQSAILTVHNHVITRNPRI 107
            :|::|....||:.:.|            |.|..|....|.|:.  .|:.::|||.|...:.:|||
  Fly   230 DNLVSAVHLFTEAVLN------------CRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRI 282

  Fly   108 SVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPP--NIDD-ALTSSDII 169
            .|   |......|.|.||..|.||.|.||||::|...:.....:.|:.||  .||: .....|..
  Fly   283 RV---KFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRY 344

  Fly   170 VREGDNVTLRCKAKGS----PEPTIKWKRDDGNKIV---INKTLEVHDLETDSLELERISRLHMG 227
            .:.|..|.|:|:...|    ...||....|..|..|   ||:|         :.||..|..::..
  Fly   345 YKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINET---------TSELNLIGNVNQT 400

  Fly   228 AYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQ 292
            .:. .:...:....:|.|..:.|..|:..:.::.:.:.                  :.|      
  Fly   401 QHK-FSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVS------------------DVW------ 440

  Fly   293 MITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKC 332
                                .|.|::|.:.:.||.|||.|
  Fly   441 --------------------LTSRISIGDAKLSDSGNYSC 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 30/97 (31%)
Ig 69..139 CDD:143165 26/71 (37%)
IG_like 165..249 CDD:214653 19/90 (21%)
IGc2 172..237 CDD:197706 16/71 (23%)
IG_like 267..348 CDD:214653 9/65 (14%)
Ig 270..339 CDD:299845 9/62 (15%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 29/97 (30%)
Ig <258..326 CDD:299845 24/70 (34%)
IGc2 <417..461 CDD:197706 12/87 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.