DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr8

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:106/250 - (42%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LYVGLGCLIA-----SSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKL 71
            :::|:.||:|     :|....||...:......||.|.:..|.         .|||...|:.|||
  Fly     7 IFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIG---------TNITGLVGKTVKL 62

  Fly    72 ACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYM 136
            .|.|||||:..|:|:......:|||..:..|.:.|....|..|.:  .|.|.|...|.:|.|.|.
  Fly    63 TCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAE--DWTLRIRYAQRKDSGIYE 125

  Fly   137 CQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPE--PTIKWKRDDGNK 199
            |||:|........::.:|.|  :.|.:...::.:..|..:.|.|..|.:||  ||:.|..   |:
  Fly   126 CQISTTPPIGHSVYLNIVEP--VTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSH---NR 185

  Fly   200 IVIN---------KTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRI 245
            .:||         ...|...|.|..|.:::......|.|.|..||..|.||...|
  Fly   186 EIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 33/95 (35%)
Ig 69..139 CDD:143165 26/69 (38%)
IG_like 165..249 CDD:214653 24/91 (26%)
IGc2 172..237 CDD:197706 21/75 (28%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 32/81 (40%)
V-set 52..143 CDD:284989 32/92 (35%)
IG_like 153..238 CDD:214653 24/87 (28%)
ig 153..232 CDD:278476 21/81 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.