DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr8

DIOPT Version :10

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:106/250 - (42%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LYVGLGCLIA-----SSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKL 71
            :::|:.||:|     :|....||...:......||.|.:..|.         .|||...|:.|||
  Fly     7 IFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIG---------TNITGLVGKTVKL 62

  Fly    72 ACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYM 136
            .|.|||||:..|:|:......:|||..:..|.:.|....|..|.:  .|.|.|...|.:|.|.|.
  Fly    63 TCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAE--DWTLRIRYAQRKDSGIYE 125

  Fly   137 CQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPE--PTIKWKRDDGNK 199
            |||:|........::.:|.|  :.|.:...::.:..|..:.|.|..|.:||  ||:.|..   |:
  Fly   126 CQISTTPPIGHSVYLNIVEP--VTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSH---NR 185

  Fly   200 IVIN---------KTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRI 245
            .:||         ...|...|.|..|.:::......|.|.|..||..|.||...|
  Fly   186 EIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 33/95 (35%)
Ig strand B 69..73 CDD:409353 3/3 (100%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 117..124 CDD:409353 2/6 (33%)
Ig 157..249 CDD:472250 25/99 (25%)
Ig strand B 176..180 CDD:409289 1/3 (33%)
Ig strand C 189..193 CDD:409289 1/3 (33%)
Ig strand E 213..218 CDD:409289 2/4 (50%)
Ig strand F 228..233 CDD:409289 2/4 (50%)
Ig strand G 242..245 CDD:409289 0/2 (0%)
IG_like 267..348 CDD:214653
Ig strand C 283..287 CDD:409394
Ig strand E 313..319 CDD:409394
Ig strand F 329..334 CDD:409394
dpr8NP_727781.1 IG_like 51..131 CDD:214653 32/81 (40%)
Ig strand B 60..64 CDD:409353 3/3 (100%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 109..113 CDD:409353 2/3 (67%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.