DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Negr1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:330 Identity:96/330 - (29%)
Similarity:148/330 - (44%) Gaps:69/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV-THDKHDKHRTWF 121
            ::|:.|..|....|.|.::: |:.|.||::  :|:|:.......:.:||:|: |.:|.|    :.
Mouse    39 VDNMLVRKGDTAVLRCYLED-GASKGAWLN--RSSIIFAGGDKWSVDPRVSISTLNKRD----YS 96

  Fly   122 LHINNVQEEDRGRYMCQINTV-TAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGS 185
            |.|.||...|.|.|.|.:.|. |.:|....:.|.|||.|.|  .|:|:.:.||.||||.|.|.|.
Mouse    97 LQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYD--ISNDMTINEGTNVTLTCLATGK 159

  Fly   186 PEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVP-PSVSKRIKVSV 249
            |||.|.|:.       |:.:.:..: ....|::..|:|...|.|.|.|.|.|. |.| |:::|.|
Mouse   160 PEPVISWRH-------ISPSAKPFE-NGQYLDIYGITRDQAGEYECSAENDVSFPDV-KKVRVIV 215

  Fly   250 DFSPMV--------------WIPHQLVGIPIGFNITLECFIEANPTSLNYWTRE----NDQMITE 296
            :|:|.:              .|..:..|:|              |.:..::..|    |.|....
Mouse   216 NFAPTIQEIKSGTVTPGRSGLIRCEGAGVP--------------PPAFEWYKGEKRLFNGQQGII 266

  Fly   297 SSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYM-----SSPPTTQ 356
            ...:.|.:|           ||:|||....:|||.|||.|..|..:.::.|..     :|.|.|.
Mouse   267 IQNFSTRSI-----------LTVTNVTQEHFGNYTCVAANKLGTTNASLPLNQIIEPTTSSPVTS 320

  Fly   357 PPPTT 361
            |.|:|
Mouse   321 PAPST 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 29/97 (30%)
Ig 69..139 CDD:143165 22/70 (31%)
IG_like 165..249 CDD:214653 30/84 (36%)
IGc2 172..237 CDD:197706 23/64 (36%)
IG_like 267..348 CDD:214653 19/84 (23%)
Ig 270..339 CDD:299845 18/72 (25%)
Negr1XP_036019026.1 FR1 38..55 CDD:409353 4/15 (27%)
Ig strand A' 40..46 CDD:409353 2/5 (40%)
IG_like 41..129 CDD:214653 28/94 (30%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 0/4 (0%)
FR2 61..68 CDD:409353 3/8 (38%)
Ig strand C 61..67 CDD:409353 3/5 (60%)
CDR2 69..79 CDD:409353 2/9 (22%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 14/38 (37%)
Ig strand D 84..91 CDD:409353 3/6 (50%)
Ig strand E 94..100 CDD:409353 2/9 (22%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A' 139..144 CDD:409353 2/4 (50%)
IGc2 146..204 CDD:197706 23/65 (35%)
Ig strand B 150..157 CDD:409353 4/6 (67%)
Ig strand C 163..168 CDD:409353 2/4 (50%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand E 180..186 CDD:409353 1/5 (20%)
Ig strand F 193..200 CDD:409353 3/6 (50%)
Ig_3 219..295 CDD:404760 21/100 (21%)
putative Ig strand A 219..225 CDD:409353 1/5 (20%)
Ig strand B 235..239 CDD:409353 1/3 (33%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/14 (14%)
Ig strand F 288..293 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833595
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.