Sequence 1: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032740.2 | Gene: | Prtg / 315806 | RGDID: | 1307157 | Length: | 1193 | Species: | Rattus norvegicus |
Alignment Length: | 310 | Identity: | 66/310 - (21%) |
---|---|---|---|
Similarity: | 116/310 - (37%) | Gaps: | 47/310 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 VPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNV 127
Fly 128 QEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVT--------LRCKAKG 184
Fly 185 SPEPTIKWKRDDGNKIVINKTLEVHD---LETDSLELERISRLHMGAYLCIASNGVPPSVSKRIK 246
Fly 247 VSVDFSPMVWI--PHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHP 309
Fly 310 SYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKL--YMSSPPTTQP 357 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | 18/91 (20%) |
Ig | 69..139 | CDD:143165 | 13/69 (19%) | ||
IG_like | 165..249 | CDD:214653 | 23/94 (24%) | ||
IGc2 | 172..237 | CDD:197706 | 22/75 (29%) | ||
IG_like | 267..348 | CDD:214653 | 17/82 (21%) | ||
Ig | 270..339 | CDD:299845 | 15/68 (22%) | ||
Prtg | NP_001032740.2 | Ig | 32..124 | CDD:416386 | |
Ig strand A | 32..35 | CDD:409353 | |||
Ig strand A' | 38..44 | CDD:409353 | |||
Ig strand B | 48..58 | CDD:409353 | |||
Ig strand C | 62..68 | CDD:409353 | |||
Ig strand C' | 70..73 | CDD:409353 | |||
Ig strand D | 78..83 | CDD:409353 | |||
Ig strand E | 85..91 | CDD:409353 | |||
Ig strand F | 103..110 | CDD:409353 | |||
Ig strand G | 114..124 | CDD:409353 | |||
Ig | 131..218 | CDD:416386 | 18/91 (20%) | ||
Ig strand B | 146..150 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 159..163 | CDD:409353 | 1/4 (25%) | ||
Ig strand E | 183..187 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 197..202 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 211..214 | CDD:409353 | 0/2 (0%) | ||
Ig_3 | 230..302 | CDD:404760 | 22/77 (29%) | ||
Ig strand B | 247..251 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 260..264 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 282..286 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 296..301 | CDD:409353 | 2/4 (50%) | ||
I-set | 322..407 | CDD:400151 | 20/96 (21%) | ||
Ig strand C | 352..357 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 359..362 | CDD:409353 | 0/2 (0%) | ||
Ig strand D | 367..371 | CDD:409353 | 1/11 (9%) | ||
Ig strand E | 373..378 | CDD:409353 | 1/6 (17%) | ||
Ig strand F | 387..394 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 398..407 | CDD:409353 | 1/8 (13%) | ||
FN3 | 414..507 | CDD:238020 | 1/4 (25%) | ||
FN3 | 512..605 | CDD:238020 | |||
fn3 | 619..694 | CDD:394996 | |||
FN3 | 721..809 | CDD:238020 | |||
FN3 | 816..906 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 974..1018 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1078..1193 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12231 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |