DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Dscaml1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001101611.1 Gene:Dscaml1 / 315615 RGDID:1304887 Length:2111 Species:Rattus norvegicus


Alignment Length:470 Identity:102/470 - (21%)
Similarity:174/470 - (37%) Gaps:87/470 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLYVGLGCLIASSV----ALST-------DTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVP 64
            |.....|.|..|.|    ||||       ....|....|....::.:.....|...|...:..|.
  Rat   232 FFITSHGGLYISDVQKEDALSTYRCITQHKYSGETRQSNGARLSVTDPAESIPTILDGFHSQEVW 296

  Fly    65 AGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQE 129
            .|..|:|.|:........:.|:                ::.| .:..|.....|...|.|::::.
  Rat   297 TGHAVELPCAASGYPIPAIRWL----------------KDGR-PLPADSRWAKRITGLTISDLRT 344

  Fly   130 EDRGRYMCQI-NTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWK 193
            ||.|.|:|:: ||..:....|.:.|:.|.::  .||...:....|..|.|.|...||||.||:|.
  Rat   345 EDSGTYICEVTNTFGSAEANGVLTVIDPLHV--TLTPKKLKTGIGSTVILSCALTGSPEFTIRWY 407

  Fly   194 RDDGNKIVI-NKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWI 257
            |:  .::|: .:.:.:..|..::|.:....:.|.|||.|.|:.....:....|.|..|.:|.:..
  Rat   408 RN--TELVLPGEAISIRGLSNETLLISSAQKSHSGAYQCFATRKAQTAQDFAIIVLEDGTPRIVS 470

  Fly   258 PHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATM------- 315
            ......:..|...:|.|..:..|.....|..:::.::.:.|         |.:.:.||       
  Rat   471 SFSEKVVNPGEQFSLMCAAKGAPPPTVTWALDDEPVVRDGS---------HRTNQYTMSDGTTIS 526

  Fly   316 RLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDGYI 380
            .:.:|..|..|.|.|:|.|:|..|..:...::.:..||:.:      .:|..|..|..       
  Rat   527 HMNVTGPQIRDGGVYRCTARNSVGSAEYQARINVRGPPSIR------AMRNITAVAGR------- 578

  Fly   381 NTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEI--DKSKQKLTGSSPKGFDWSKGKSSGSH 443
            :|.:|...||.    |..| |...|.::....|..::  :....|||       |..||...|.:
  Rat   579 DTLINCRVIGY----PYYS-IKWYKDALLLPDNHRQVVFENGTLKLT-------DVQKGMDEGEY 631

  Fly   444 GNLMASSWPLICCIL 458
                      :|.:|
  Rat   632 ----------LCSVL 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 20/96 (21%)
Ig 69..139 CDD:143165 14/69 (20%)
IG_like 165..249 CDD:214653 23/84 (27%)
IGc2 172..237 CDD:197706 21/65 (32%)
IG_like 267..348 CDD:214653 18/87 (21%)
Ig 270..339 CDD:299845 16/75 (21%)
Dscaml1NP_001101611.1 IG 101..173 CDD:214652
IGc2 101..168 CDD:197706
Ig 183..276 CDD:299845 11/43 (26%)
IG_like 195..276 CDD:214653 11/43 (26%)
I-set 291..369 CDD:254352 19/94 (20%)
IGc2 298..359 CDD:197706 17/77 (22%)
IGc2 386..447 CDD:197706 20/62 (32%)
I-set 466..560 CDD:254352 19/102 (19%)
Ig 466..556 CDD:299845 19/98 (19%)
IGc2 577..635 CDD:197706 17/86 (20%)
IG_like 665..744 CDD:214653
Ig 673..739 CDD:143165
I-set 748..843 CDD:254352
Ig7_DSCAM 765..843 CDD:143211
I-set 849..942 CDD:254352
Ig 861..949 CDD:299845
FN3 945..1039 CDD:238020
FN3 1046..1143 CDD:238020
fn3 1151..1237 CDD:278470
FN3 1249..1340 CDD:238020
IGc2 1364..1428 CDD:197706
FN3 1442..1532 CDD:238020
FN3 1546..1618 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.