DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Jaml

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_038938277.1 Gene:Jaml / 315610 RGDID:1562572 Length:379 Species:Rattus norvegicus


Alignment Length:384 Identity:71/384 - (18%)
Similarity:135/384 - (35%) Gaps:107/384 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PEFTDVIENITVPAGRNVKLACSVKNLGSY---KVAWM-----HFEQSAILTVHNHVITRNPRIS 108
            |:.|.....:.|..|.:..:.|.|::....   ||.|:     |.|...:|..::.:.....|..
  Rat    24 PDLTVSSLKLRVHVGESALMGCVVQSTEEKPVDKVDWVFSKGEHAENEYVLYYYSSLSVPTGRFQ 88

  Fly   109 ----VTHD--KHDKHRTWFLHINNVQEEDRGRYMCQI-----NTVTAKTQYGFVKVVVPPNIDDA 162
                :..|  ::|..    |.:.:||:.|.|.|.|:|     .:|:.|    ||.:.|.|.    
  Rat    89 NRSRLVGDLLRNDGS----LLLQDVQKADEGIYTCEIRLKNEGSVSKK----FVLLHVLPE---- 141

  Fly   163 LTSSDIIVREGDNVTLRCKAKGSPE---PTIKWKRDDG----NKIVINKTLEVH----------- 209
             ...::.|..||.:.:.|..:.:.|   ..:.|....|    .:||::....:|           
  Rat   142 -EPKELRVHVGDPIQMGCFFRSTEERRVTRVNWMFSSGKHAQEEIVLSYDFNMHSGTFQGQGRFR 205

  Fly   210 ---DLETD------SLELERISRLHMGAYLC----------------IASNGVPPSVSKRIKVS- 248
               ||..|      |:.|:.:.:...|.|.|                :..:..|.|:|...:.: 
  Rat   206 NRVDLTGDISRNDGSIMLQTVKKSDQGVYTCSIYLGKLESRKTIVLHVIQDESPRSISTTTETAG 270

  Fly   249 -----VDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGH 308
                 :|.:.:|.|    |||.....:.|...|                :|.:.:|:...::...
  Rat   271 KQQGILDGNQLVII----VGIVCATLLLLPVLI----------------LIVKKTKWNKSSVSSI 315

  Fly   309 PSYKATMRLTITNVQSSDYGN---YKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTL 364
            .|.|:......|:.:...|.:   ::...:.|.|:.:..   ||:..|..:..|..::|
  Rat   316 ASVKSLENKEKTSSEKHVYSSITTWETAERGPSGESEAT---YMTMHPVWRSSPKASSL 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/114 (22%)
Ig 69..139 CDD:143165 18/83 (22%)
IG_like 165..249 CDD:214653 21/132 (16%)
IGc2 172..237 CDD:197706 17/107 (16%)
IG_like 267..348 CDD:214653 10/83 (12%)
Ig 270..339 CDD:299845 9/71 (13%)
JamlXP_038938277.1 V-set 33..139 CDD:400157 25/113 (22%)
FR2 58..69 CDD:409353 3/10 (30%)
CDR2 70..82 CDD:409353 1/11 (9%)
Ig strand C' 71..77 CDD:409353 1/5 (20%)
Ig strand C' 78..82 CDD:409353 0/3 (0%)
FR3 87..121 CDD:409353 9/37 (24%)
Ig strand D 90..96 CDD:409353 0/5 (0%)
Ig strand E 100..108 CDD:409353 2/11 (18%)
Ig strand F 115..122 CDD:409353 3/6 (50%)
V-set 141..253 CDD:400157 18/116 (16%)
Ig strand A' 144..150 CDD:409353 1/5 (20%)
Ig strand B 152..162 CDD:409353 2/9 (22%)
CDR1 162..169 CDD:409353 1/6 (17%)
Ig strand C 169..176 CDD:409353 1/6 (17%)
FR2 170..181 CDD:409353 2/10 (20%)
CDR2 182..196 CDD:409353 3/13 (23%)
Ig strand C' 183..189 CDD:409353 2/5 (40%)
Ig strand C' 191..196 CDD:409353 1/4 (25%)
FR3 204..238 CDD:409353 8/33 (24%)
Ig strand D 207..213 CDD:409353 2/5 (40%)
Ig strand E 217..225 CDD:409353 2/7 (29%)
Ig strand F 232..238 CDD:409353 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.