DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Igsf9b

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:475 Identity:110/475 - (23%)
Similarity:166/475 - (34%) Gaps:103/475 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ISEDPEFTDVIENITVPAGRNVKLACSVKN--LGS---YKVAWMHFEQSAILTVH-----NHVIT 102
            :.|:|||      :|..||..|.|.|.|.:  .|.   |.|.|..|.....:.:.     .||  
  Rat    26 LREEPEF------VTARAGEGVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHV-- 82

  Fly   103 RNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQY------GFVKVVV--PPNI 159
             :|..:.....|||..   |.:..|:.||:|.|.|::  :....||      .:|.:.:  ||..
  Rat    83 -DPEYAGRASLHDKAS---LRLEQVRSEDQGWYECKV--LMLDQQYDTFHNGSWVHLTINAPPTF 141

  Fly   160 DDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRL 224
            .:. ....|..:||.::|:.|.|.|:|:|.:.|.: :|..:..:...:|.|   .||.:..:||.
  Rat   142 TET-PPQYIEAKEGGSITMTCTAFGNPKPIVTWLK-EGTLLSASGKYQVSD---GSLTVTSVSRE 201

  Fly   225 HMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLN---YW 286
            ..|||.|.|.: :.........:.|...|.:..|.:.:.:.|..:..|.|..||.|.:|.   ||
  Rat   202 DRGAYTCRAYS-IQGEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTCRAEAYPGNLTYTWYW 265

  Fly   287 TRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDG-------- 343
            ..||.....:........|.|        .|.|..|:..|.|.|.||..|..|....        
  Rat   266 QDENVYFQNDLKLRVRILIDG--------TLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTVQ 322

  Fly   344 ----------------NIKLYMSSPPTTQPPPTTT-----------------TLRRTTT----TA 371
                            .|..|:..|...:||.|..                 ||....:    .|
  Rat   323 YPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVKWNKDGRPLQVEKNLGWTLMEDGSIRIEEA 387

  Fly   372 AEIALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEIDKSKQKL------TGSSPK 430
            .|.||..|...|.  |.:|.:|:.....::.........|.......::.::|      .|....
  Rat   388 TEEALGTYTCVPY--NTLGTMGQSAPARLVLKDPPYFTVLPGWEYRQEAGRELLIPCAAAGDPFP 450

  Fly   431 GFDWSK-GKSSGSHGNLMAS 449
            ...|.| ||.|.|..|.:.|
  Rat   451 VITWRKVGKPSRSKHNALPS 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 28/111 (25%)
Ig 69..139 CDD:143165 22/79 (28%)
IG_like 165..249 CDD:214653 22/83 (27%)
IGc2 172..237 CDD:197706 21/64 (33%)
IG_like 267..348 CDD:214653 23/107 (21%)
Ig 270..339 CDD:299845 21/71 (30%)
Igsf9bNP_001363879.1 PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Ig 41..115 CDD:319273 22/79 (28%)
I-set 139..225 CDD:369462 23/91 (25%)
Ig 229..321 CDD:386229 25/99 (25%)
Ig <353..414 CDD:386229 13/62 (21%)
Ig 438..502 CDD:319273 10/33 (30%)
FN3 510..605 CDD:238020
FN3 621..703 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.