DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Fas2

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:383 Identity:91/383 - (23%)
Similarity:153/383 - (39%) Gaps:67/383 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRN-PRISVTHDKHDKH 117
            :|:..||.....|::..:.|.||...:..:.|:                || ..|..|:||:...
  Fly   140 WTNAPENQYPTLGQDYVVMCEVKADPNPTIDWL----------------RNGDPIRTTNDKYVVQ 188

  Fly   118 RTWFLHINNVQEEDRGRYMCQ---INTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLR 179
            ....| |.||||.|.|.|.|:   |.|.....:...|:|.:.|.|....|:.:.:  ||......
  Fly   189 TNGLL-IRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNLEAV--EGKPFAAN 250

  Fly   180 CKAKGSPEPTIKWKRD-------DGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASN-- 235
            |.|:|.|.|.|.|.||       ..::..:|.       :|..:.:..:|:...|.|.|:|.|  
  Fly   251 CTARGKPVPEISWIRDATQLNVATADRFQVNP-------QTGLVTISSVSQDDYGTYTCLAKNRA 308

  Fly   236 GVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPT---SLNYWTRENDQMITES 297
            ||   |.::.|::|...|.::..:.:.|.... .|.:.|..:..|.   :...|..:.:  .|..
  Fly   309 GV---VDQKTKLNVLVRPQIYELYNVTGARTK-EIAITCRAKGRPAPAITFRRWGTQEE--YTNG 367

  Fly   298 SKYKTETIPGHPSY-----KATMRLTITNVQSSDYGNYKCVAKNPRGD--MDGNIKLYMS---SP 352
            .:.....|...|::     ::|..|.|:|.:.||.|.|:|:|:|...|  ..|:|.:..:   |.
  Fly   368 QQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSH 432

  Fly   353 PTTQPPPTTTTLRRTTTTAAEIAL-DGYINTPLNG--------NGIGIVGEGPTNSVI 401
            ....||..:...|:...:...:.: :..|....||        ..:.|||.||.:.:|
  Fly   433 MKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLI 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 27/99 (27%)
Ig 69..139 CDD:143165 20/73 (27%)
IG_like 165..249 CDD:214653 23/92 (25%)
IGc2 172..237 CDD:197706 19/73 (26%)
IG_like 267..348 CDD:214653 21/90 (23%)
Ig 270..339 CDD:299845 18/76 (24%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 26/98 (27%)
IGc2 152..209 CDD:197706 21/73 (29%)
I-set 230..319 CDD:254352 26/100 (26%)
IGc2 243..309 CDD:197706 19/72 (26%)
IG_like 330..424 CDD:214653 22/96 (23%)
IGc2 339..412 CDD:197706 17/74 (23%)
Ig 447..518 CDD:143165 9/44 (20%)
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.