DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:225 Identity:64/225 - (28%)
Similarity:92/225 - (40%) Gaps:39/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTW 120
            ||..|:||..|:...|.|.|:.||...|:|:......|||......|.:.|..|.  :.|....|
  Fly    58 DVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVL--RPDGSANW 120

  Fly   121 FLHINNVQEEDRGRYMCQINTVTAKT-QYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKG 184
            .|.|...|..|.|.|.|||||....: .|.|..|.:...|   ...||::|:.|.::.|.||...
  Fly   121 TLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEI---FGPSDLMVKTGSDINLTCKIMQ 182

  Fly   185 SPEP--TIKWKRDDGNKIVINK----------TLEVHDLETDS----LELERISRLHMGAYLCIA 233
            .|..  .|.|.:  |::::..|          .:.|.|..||.    |:::|......|.|.|: 
  Fly   183 GPHELGNIFWYK--GSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV- 244

  Fly   234 SNGVPPSVSKRIKVSVDFSPMVWIPHQLVG 263
                 |:|:|...|.|         |.::|
  Fly   245 -----PTVAKTSSVYV---------HVIIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 33/96 (34%)
Ig 69..139 CDD:143165 22/69 (32%)
IG_like 165..249 CDD:214653 25/99 (25%)
IGc2 172..237 CDD:197706 18/80 (23%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
dpr1NP_001286645.1 Ig 59..154 CDD:299845 33/96 (34%)
IG_like 60..150 CDD:214653 30/91 (33%)
IG_like 163..257 CDD:214653 26/110 (24%)
Ig 174..244 CDD:143165 16/71 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.