DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and dpr9

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:296 Identity:73/296 - (24%)
Similarity:111/296 - (37%) Gaps:70/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ASSVALSTDTGSEGNAGNVGGSTL------------------------------NNVISED---- 51
            :.|.||:||    .:..:|||:|.                              |::..|:    
  Fly   194 SESAALTTD----ASRSSVGGATTITGIPSSSLHKASSASSNTFSSQLASGFHRNSIDLEEARNA 254

  Fly    52 -PEFTDVI-ENITVPAGRNVKLACSVKNLGS----YKVAWMHFEQSAILTVHNHVITRNPRISVT 110
             |.|.... :|:|...|:...|.|.|||||:    .:|:|:......:|||..:..|.:.|....
  Fly   255 GPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAI 319

  Fly   111 HDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDN 175
            |....:  .|.|.|...|..|.|.|.||::|....:.|..:.||.|..  :.:.:.|:.:..|..
  Fly   320 HQPQTE--DWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPST--EIIGAPDLYIESGST 380

  Fly   176 VTLRCKAKGSPEPT--IKWKRDD----------------GNKIVINKTLEVHDLETDSLELERIS 222
            :.|.|..:.||||.  |.|..::                |..:|.||    .|..|..|.::...
  Fly   381 INLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNK----GDTTTSFLLIKSAR 441

  Fly   223 RLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIP 258
            ....|.|.|..||..|.||:..:...|..|....:|
  Fly   442 PSDSGHYQCNPSNAKPKSVTVHVLNGVSHSVSRGVP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 30/99 (30%)
Ig 69..139 CDD:143165 23/73 (32%)
IG_like 165..249 CDD:214653 25/101 (25%)
IGc2 172..237 CDD:197706 21/82 (26%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
dpr9NP_001287332.1 Ig 263..361 CDD:299845 29/99 (29%)
IG_like 263..360 CDD:214653 29/98 (30%)
IG_like 371..464 CDD:214653 25/96 (26%)
IGc2 377..456 CDD:197706 21/82 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.