DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and CNTN6

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001276009.1 Gene:CNTN6 / 27255 HGNCID:2176 Length:1028 Species:Homo sapiens


Alignment Length:470 Identity:101/470 - (21%)
Similarity:158/470 - (33%) Gaps:108/470 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VGGSTLNNVISEDPEFTDVIENITVP---AGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHV 100
            :..|..:.::|. |.||....::..|   :...|.|.|:.....|....|..             
Human    14 INSSAGDGLLSR-PIFTQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQ------------- 64

  Fly   101 ITRNPRISVTHDKHDKHRTWFLHINNVQ-EEDRGRYMC----QINTV---TAKTQYGFVKVVVPP 157
              ....|..|...|.:.....|.||:.. ::|.|.|.|    .:.|:   .||.|:.:::..   
Human    65 --NGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQFAYIEDF--- 124

  Fly   158 NIDDALTSSDIIVREGDNVTLRCKAKGSPEP-----TIKWKRDDGNKIVINKTLEVHDLETDSLE 217
               :..|.|.:.||||..|.|.|    .|.|     :..|..:|....|..........||.:|.
Human   125 ---ETKTRSTVSVREGQGVVLLC----GPPPHFGDLSYAWTFNDNPLYVQEDNRRFVSQETGNLY 182

  Fly   218 LERISRLHMGAYLCIASN--------GVP-PSVSKRIKVSVDFSPMVWIPH-QLVGIPIGFNITL 272
            :.::....:|.|.|..:|        |.| |.|.:...|..::.|.:.:.. :.:......::.|
Human   183 IAKVEPSDVGNYTCFITNKEAQRSVQGPPTPLVQRTDGVMGEYEPKIEVRFPETIQAAKDSSVKL 247

  Fly   273 ECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSY-KATMRLTITNVQSSDYGNYKCVAKN 336
            |||...||.....|.|.:.           ..:||...| |:...|.|.|.|..|.|.|:|:|.|
Human   248 ECFALGNPVPDISWRRLDG-----------SPLPGKVKYSKSQAILEIPNFQQEDEGFYECIASN 301

  Fly   337 PRGDMDGNIKLYMSSPP-----------------------TTQPPPTTTTL----RRTTTTAAEI 374
            .||......:|...:||                       :.:|.|..|.|    |.......:|
Human   302 LRGRNLAKGQLIFYAPPEWEQKIQNTHLSIYDNLLWECKASGKPNPWYTWLKNGERLNPEERIQI 366

  Fly   375 ALDGYINTPLNGNGIGIVGEGPTNSV-IASGKSSIKYLSNLNEIDKSKQK-----------LTGS 427
            .....|.|.||.:..|:......|.. |....:.::.|::..:..||..|           :.|.
Human   367 ENGTLIITMLNVSDSGVYQCAAENKYQIIYANAELRVLASAPDFSKSPVKKKSFVQVGGDIVIGC 431

  Fly   428 SPKGF-----DWSKG 437
            .|..|     .|.:|
Human   432 KPNAFPRAAISWKRG 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 20/106 (19%)
Ig 69..139 CDD:143165 15/74 (20%)
IG_like 165..249 CDD:214653 25/97 (26%)
IGc2 172..237 CDD:197706 17/77 (22%)
IG_like 267..348 CDD:214653 24/81 (30%)
Ig 270..339 CDD:299845 22/69 (32%)
CNTN6NP_001276009.1 Ig 26..118 CDD:325142 22/106 (21%)
Ig 120..214 CDD:325142 23/103 (22%)
Ig 227..315 CDD:325142 26/98 (27%)
Ig 319..403 CDD:325142 13/83 (16%)
Ig 424..496 CDD:325142 5/23 (22%)
Ig 515..598 CDD:325142
FN3 598..691 CDD:238020
FN3 703..796 CDD:238020
FN3 805..898 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..908
FN3 906..991 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.