DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and MXRA5

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_056234.2 Gene:MXRA5 / 25878 HGNCID:7539 Length:2828 Species:Homo sapiens


Alignment Length:384 Identity:99/384 - (25%)
Similarity:153/384 - (39%) Gaps:55/384 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IASSVALSTDTGSEGNAGNVGGSTLNNV--ISEDPE-FTDVIENITVPAGRNVKLACSVKNLGSY 81
            |.|||..|.......:....||...:..  :.|.|: .|...:.::|.|..:....|........
Human  1819 ITSSVQSSGSFHQSSSKFFAGGPPASKFWSLGEKPQILTKSPQTVSVTAETDTVFPCEATGKPKP 1883

  Fly    82 KVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKT 146
            .|.|......|::|.:    ||..|..|.     |:.|  |.|..||.:|||:|||     ||..
Human  1884 FVTWTKVSTGALMTPN----TRIQRFEVL-----KNGT--LVIRKVQVQDRGQYMC-----TASN 1932

  Fly   147 QYGFVKVVV-------PPNIDDALTS--SDIIVREGDNVTLRCKAKGSPEPTIKW----KRDDGN 198
            .:|..::||       .|.|   |.|  .|:.|..||.:.:.|.|||:|.|.|.|    :|....
Human  1933 LHGLDRMVVLLSVTVQQPQI---LASHYQDVTVYLGDTIAMECLAKGTPAPQISWIFPDRRVWQT 1994

  Fly   199 KIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGV-PPSVSKRIKVSVDFSPMVWIPHQ-- 260
            ...:...:.:|  |..:|.::..|....|.|.|:|||.. ..|::.|:.|:. ..|::   ||  
Human  1995 VSPVEGRITLH--ENRTLSIKEASFSDRGVYKCVASNAAGADSLAIRLHVAA-LPPVI---HQEK 2053

  Fly   261 --LVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQ 323
              .:.:|.|.:|.:.|..:|.|.....|...:...|..|     :.:.|:........|.|.|:.
Human  2054 LENISLPPGLSIHIHCTAKAAPLPSVRWVLGDGTQIRPS-----QFLHGNLFVFPNGTLYIRNLA 2113

  Fly   324 SSDYGNYKCVAKN----PRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDG 378
            ..|.|.|:|||.|    .|..:..|::...::...|...|..|.:|...|...:.:..|
Human  2114 PKDSGRYECVAANLVGSARRTVQLNVQRAAANARITGTSPRRTDVRYGGTLKLDCSASG 2172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 26/95 (27%)
Ig 69..139 CDD:143165 21/69 (30%)
IG_like 165..249 CDD:214653 27/90 (30%)
IGc2 172..237 CDD:197706 21/68 (31%)
IG_like 267..348 CDD:214653 21/84 (25%)
Ig 270..339 CDD:299845 18/72 (25%)
MXRA5NP_056234.2 leucine-rich repeat 38..55 CDD:275380
LRR_8 55..115 CDD:290566
LRR 1 56..77
leucine-rich repeat 57..80 CDD:275380
LRR 2 80..101
leucine-rich repeat 81..104 CDD:275380
LRR_8 102..163 CDD:290566
LRR 3 104..125
leucine-rich repeat 105..128 CDD:275380
LRR_4 128..168 CDD:289563
LRR 4 128..149
leucine-rich repeat 129..152 CDD:275380
LRR 5 152..173
leucine-rich repeat 153..184 CDD:275380
LRR 6 184..205
leucine-rich repeat 185..208 CDD:275380
LRRCT 217..>263 CDD:214507
IG 486..572 CDD:214652
IGc2 493..558 CDD:197706
IG 590..668 CDD:214652
IGc2 591..658 CDD:197706
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..715
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 933..962
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1068..1190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1204..1275
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1367..1389
LRR 7 1410..1434
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1479..1499
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1536..1566
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1579..1603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1669..1689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1700..1719
IG_like 1860..1945 CDD:214653 28/100 (28%)
Ig 1868..1945 CDD:299845 26/92 (28%)
I-set 1958..2042 CDD:254352 25/85 (29%)
IGc2 1965..2032 CDD:197706 21/68 (31%)
I-set 2047..2139 CDD:254352 24/99 (24%)
Ig 2065..2137 CDD:299845 19/76 (25%)
IG_like 2153..2238 CDD:214653 5/20 (25%)
Ig 2161..2229 CDD:299845 2/12 (17%)
IG 2258..2341 CDD:214652
Ig 2258..2332 CDD:299845
IG_like 2356..2435 CDD:214653
Ig 2361..2435 CDD:299845
I-set 2440..2535 CDD:254352
Ig 2459..2535 CDD:299845
IG 2549..2633 CDD:214652
Ig 2561..2633 CDD:299845
IG 2652..2728 CDD:214652
Ig 2655..2724 CDD:143165
IG_like 2741..2827 CDD:214653
Ig 2751..2824 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.